RegulonDB RegulonDB 10.8: Gene Form
   

pstC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pstS pstC pstA pstB terminator pstCp pstCp pstBp1 pstBp1 pstBp pstBp phoUp phoUp phoUp2 phoUp2

Gene      
Name: pstC    Texpresso search in the literature
Synonym(s): ECK3720, EG10784, b3727, phoW
Genome position(nucleotides): 3909439 <-- 3910398 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.69
External database links:  
ASAP:
ABE-0012186
CGSC:
18001
ECHOBASE:
EB0777
OU-MICROARRAY:
b3727
PortEco:
pstC
STRING:
511145.b3727
COLOMBOS: pstC


Product      
Name: phosphate ABC transporter membrane subunit PstC
Synonym(s): PhoW, PstC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.121
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
118 -> 137 LLAAIPSIVYGMWGLFIFAP
202 -> 221 ESAYGIGCTTWEVIWRIVLP
95 -> 304 GIALFLTELAPGWLKRPLGIAIELLAAIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFIVLAA
237 -> 237 R
75 -> 305 IYGTLVTSFIALLIAVPVSFGIALFLTELAPGWLKRPLGIAIELLAAIPSIVYGMWGLFIFAPLFAVYFQEPVGNIMSNIPIVGALFSGPAFGIGILAAGVILAIMIIPYIAAVMRDVFEQTPVMMKESAYGIGCTTWEVIWRIVLPFTKNGVIGGIMLGLGRALGETMAVTFIIGNTYQLDSASLYMPGNSITSALANEFAEAESGLHVAALMELGLILFVITFIVLAAS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015415 - ATPase-coupled phosphate ion transmembrane transporter activity
GO:0005315 - inorganic phosphate transmembrane transporter activity
biological_process GO:0010921 - regulation of phosphatase activity
GO:0009314 - response to radiation
GO:0006817 - phosphate ion transport
GO:0055085 - transmembrane transport
GO:0035435 - phosphate ion transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Webb DC., et al., 1992
External database links:  
ECOCYC:
PSTC-MONOMER
ECOLIWIKI:
b3727
INTERPRO:
IPR011864
INTERPRO:
IPR035906
INTERPRO:
IPR000515
PFAM:
PF00528
PRIDE:
P0AGH8
PRODB:
PRO_000023623
PROSITE:
PS50928
REFSEQ:
NP_418183
UNIPROT:
P0AGH8


Operon      
Name: pstSCAB-phoU         
Operon arrangement:
Transcription unit        Promoter
phoU
pstB-phoU
pstB-phoU
pstCAB-phoU
pstS
pstSCA
pstSCAB-phoU


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter phoUp2 3907646 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Webb DC., Rosenberg H., Cox GB., 1992, Mutational analysis of the Escherichia coli phosphate-specific transport system, a member of the traffic ATPase (or ABC) family of membrane transporters. A role for proline residues in transmembrane helices., J Biol Chem 267(34):24661-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB