RegulonDB RegulonDB 10.9: Gene Form
   

purD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purH zraS zraR purD purDp1 purDp1

Gene      
Name: purD    Texpresso search in the literature
Synonym(s): ECK3997, EG10792, adth, adth(a), b4005
Genome position(nucleotides): 4204642 <-- 4205931 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.22
Reference(s): [1] Aiba A., et al., 1989
[2] Flannigan KA., et al., 1990
[3] Peterson JW., et al., 1991
External database links:  
ASAP:
ABE-0013095
CGSC:
342
ECHOBASE:
EB0785
ECOLIHUB:
purD
OU-MICROARRAY:
b4005
STRING:
511145.b4005
COLOMBOS: purD


Product      
Name: phosphoribosylamine—glycine ligase
Synonym(s): PurD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.94
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
135 -> 196 LREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEAS
1 -> 102 MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQNVAIGVTDIPALLDFAQNEKIDLTIVGPEAPLVKGVVDTFRAAGLKIFGPTAGAAQLE
103 -> 296 GSKAFTKDFLARHKIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVTDDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPET
15 -> 16 LA
109 -> 316 KDFLARHKIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEEAEAAVHDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVTDDVHQRTMERIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGNPKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016887 - ATPase activity
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004637 - phosphoribosylamine-glycine ligase activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0006189 - 'de novo' IMP biosynthetic process
GO:0009113 - purine nucleobase biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GLYCRIBONUCSYN-MONOMER
ECOLIWIKI:
b4005
INTERPRO:
IPR020560
INTERPRO:
IPR037123
INTERPRO:
IPR020562
INTERPRO:
IPR020561
INTERPRO:
IPR020559
INTERPRO:
IPR016185
INTERPRO:
IPR013815
INTERPRO:
IPR011761
INTERPRO:
IPR011054
INTERPRO:
IPR000115
MODBASE:
P15640
PDB:
1GSO
PFAM:
PF02843
PFAM:
PF01071
PFAM:
PF02844
PRIDE:
P15640
PRODB:
PRO_000023639
PROSITE:
PS50975
PROSITE:
PS00184
REFSEQ:
NP_418433
SMART:
SM01210
SMR:
P15640
UNIPROT:
P15640


Operon      
Name: purHD         
Operon arrangement:
Transcription unit        Promoter
purHD


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP
Repressed by: PurR, RbsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter purDp1 4205986 reverse Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Aiba A., Mizobuchi K., 1989, Nucleotide sequence analysis of genes purH and purD involved in the de novo purine nucleotide biosynthesis of Escherichia coli., J Biol Chem 264(35):21239-46

 [2] Flannigan KA., Hennigan SH., Vogelbacker HH., Gots JS., Smith JM., 1990, Purine biosynthesis in Escherichia coli K12: structure and DNA sequence studies of the purHD locus., Mol Microbiol 4(3):381-92

 [3] Peterson JW., Chopra AK., Prasad R., 1991, Fine mapping of the rrnE, purHD, and hydGH operons on the Escherichia coli chromosome., J Bacteriol 173(11):3274-5

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB