RegulonDB RegulonDB 10.9: Gene Form
   

purH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purH rrsE purD zraR PhoP Fis Fis Fis Fis Fis PurR RbsR DksA DksA-ppGpp DksA-ppGpp ppGpp anti-anti-terminator anti-terminator terminator TSS_4833 TSS_4833 rrsEp2 rrsEp2 rrsEp rrsEp purHp purHp purDp1 purDp1

Gene      
Name: purH    Texpresso search in the literature
Synonym(s): ECK3998, EG10795, b4006
Genome position(nucleotides): 4205943 <-- 4207532 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.29
Reference(s): [1] Peterson JW., et al., 1991
External database links:  
ASAP:
ABE-0013097
CGSC:
338
ECHOBASE:
EB0788
ECOLIHUB:
purH
MIM:
608688
OU-MICROARRAY:
b4006
STRING:
511145.b4006
COLOMBOS: purH


Product      
Name: bifunctional AICAR transformylase/IMP cyclohydrolase
Synonym(s): PurH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 57.329
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
19 -> 132 GIVEFAQALSARGVELLSTGGTARLLAEKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEEHQIQPIDMVVVNLYPFAQTVAREGCSLEDAVENIDIGGPT
137 -> 460 AAKNHKDVAIVVKSSDYDAIIKEMDDNEGSLTLATRFDLAIKAFEHTAAYDSMIANYFGSMVPAYHGESKEAAGRFPRTLNLNFIKKLDMRYGENSHQQAAFYIEENVKEASVATATQVQGKALSYNNIADTDAALECVKEFAEPACVIVKHANPCGVAIGNSILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAIISRQFVEVIIAPSASEEALKITAAKQNVRVLTCGQWGERVPGLDFKRVNGGLLVQDRDLGMVGAEELRVVTKRQPSEQELRDALFCWKVAKFVKSNAIVYAKNNMTIGIGAGQMSRVYSAKIAGIK
1 -> 148 MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLLAEKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEEHQIQPIDMVVVNLYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0003937 - IMP cyclohydrolase activity
GO:0004643 - phosphoribosylaminoimidazolecarboxamide formyltransferase activity
biological_process GO:0008152 - metabolic process
GO:0006164 - purine nucleotide biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
AICARTRANSIMPCYCLO-CPLX
ECOLIWIKI:
b4006
INTERPRO:
IPR016193
INTERPRO:
IPR036914
INTERPRO:
IPR024051
INTERPRO:
IPR011607
INTERPRO:
IPR002695
MODBASE:
P15639
PANTHER:
PTHR11692
PFAM:
PF02142
PFAM:
PF01808
PRIDE:
P15639
PRODB:
PRO_000024869
PROSITE:
PS51855
REFSEQ:
NP_418434
SMART:
SM00798
SMART:
SM00851
SMR:
P15639
UNIPROT:
P15639


Operon      
Name: purHD         
Operon arrangement:
Transcription unit        Promoter
purHD


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP
Repressed by: PurR, RbsR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter purDp1 4205986 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4833 4208032 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Peterson JW., Chopra AK., Prasad R., 1991, Fine mapping of the rrnE, purHD, and hydGH operons on the Escherichia coli chromosome., J Bacteriol 173(11):3274-5

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB