RegulonDB RegulonDB 10.8: Gene Form
   

purM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppk purM purN upp PurR FNR FNR terminator anti-terminator anti-anti-terminator TSS_2782 (cluster) TSS_2782 (cluster) TSS_2781 (cluster) TSS_2781 (cluster) ppkp6 ppkp6 ppkp ppkp ppkp5 ppkp5 purMp purMp TSS_2780 TSS_2780 uppp uppp

Gene      
Name: purM    Texpresso search in the literature
Synonym(s): ECK2495, EG10798, b2499, purG, purI
Genome position(nucleotides): 2621197 --> 2622234 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.89
Reference(s): [1] Smith JM., et al., 1986
External database links:  
ASAP:
ABE-0008230
CGSC:
335
ECHOBASE:
EB0791
OU-MICROARRAY:
b2499
PortEco:
purM
STRING:
511145.b2499
COLOMBOS: purM


Shine dalgarno      
Sequence: gtaacgcgtgGGGACCcaagcaGTG


Product      
Name: phosphoribosylformylglycinamide cyclo-ligase
Synonym(s): PurG, PurI, PurM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.854
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
59 -> 164 VLVSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISGIAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGVV
12 -> 12 A
177 -> 341 DGDVLIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKPLADHLLAPTRIYVKSVLELIEKVDVHAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQWPEVFNWLQTAGNVEHHEMYRTFNCGVGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQR
2 -> 345 TDKTSLSYKDAGVDIDAGNALVGRIKGVVKKTRRPEVMGGLGGFGALCALPQKYREPVLVSGTDGVGTKLRLAMDLKRHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDTASAVISGIAEGCLQSGCSLVGGETAEMPGMYHGEDYDVAGFCVGVVEKSEIIDGSKVSDGDVLIALGSSGPHSNGYSLVRKILEVSGCDPQTTELDGKPLADHLLAPTRIYVKSVLELIEKVDVHAIAHLTGGGFWENIPRVLPDNTQAVIDESSWQWPEVFNWLQTAGNVEHHEMYRTFNCGVGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQRVVIE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004637 - phosphoribosylamine-glycine ligase activity
GO:0004641 - phosphoribosylformylglycinamidine cyclo-ligase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
GO:0046084 - adenine biosynthetic process
External database links:  
ECOCYC:
AIRS-MONOMER
ECOLIWIKI:
b2499
INTERPRO:
IPR036921
INTERPRO:
IPR036676
INTERPRO:
IPR016188
INTERPRO:
IPR010918
INTERPRO:
IPR004733
MODBASE:
P08178
PANTHER:
PTHR10520
PDB:
1CLI
PFAM:
PF00586
PFAM:
PF02769
PRIDE:
P08178
PRODB:
PRO_000023642
REFSEQ:
NP_416994
SMR:
P08178
UNIPROT:
P08178


Operon      
Name: purMN         
Operon arrangement:
Transcription unit        Promoter
purMN


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2780 2620986 reverse nd [RS-EPT-CBR] [2]
  promoter ppkp5 2622874 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ppkp6 2622990 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2781 (cluster) 2625007 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_2782 (cluster) 2625014 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Smith JM., Daum HA., 1986, Nucleotide sequence of the purM gene encoding 5'-phosphoribosyl-5-aminoimidazole synthetase of Escherichia coli K12., J Biol Chem 261(23):10632-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB