RegulonDB RegulonDB 10.8: Gene Form
   

purR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: purR    Texpresso search in the literature
Synonym(s): ECK1654, EG10800, b1658
Genome position(nucleotides): 1737844 --> 1738869 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.8
External database links:  
ASAP:
ABE-0005545
CGSC:
17989
ECHOBASE:
EB0793
OU-MICROARRAY:
b1658
PortEco:
purR
STRING:
511145.b1658
COLOMBOS: purR


Product      
Name: DNA-binding transcriptional repressor PurR
Synonym(s): PurR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GalR/LacI
Cellular location: cytosol
Molecular weight: 38.175
Isoelectric point: 6.722
Motif(s):
 
Type Positions Sequence
4 -> 23 IKDVAKRANVSTTTVSHVIN
190 -> 190 R
2 -> 341 ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR
3 -> 48 TIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPS
48 -> 56 SAVARSLKV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.16 - histidine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.2 - pyrimidine biosynthesis
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.14 - polyamine biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.2 - regulon
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0042803 - protein homodimerization activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
GO:0002057 - guanine binding
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:1900372 - negative regulation of purine nucleotide biosynthetic process
Reference(s): [1] Meng LM., et al., 1990
[2] Rolfes RJ., et al., 1990
[3] Rolfes RJ., et al., 1988
External database links:  
DIP:
DIP-35931N
ECOCYC:
PD00219
ECOLIWIKI:
b1658
INTERPRO:
IPR010982
INTERPRO:
IPR023588
INTERPRO:
IPR000843
INTERPRO:
IPR028082
PANTHER:
PTHR30146:SF7
PDB:
1PRU
PDB:
1PRV
PDB:
1QP0
PDB:
1QP4
PDB:
1QP7
PDB:
1QPZ
PDB:
1QQA
PDB:
1VPW
PDB:
1WET
PDB:
1ZAY
PDB:
2PUA
PDB:
2PUB
PDB:
2PUC
PDB:
2PUD
PDB:
2PUE
PDB:
2PUF
PDB:
2PUG
PDB:
1PNR
PDB:
1JHZ
PDB:
1JH9
PDB:
1JFT
PDB:
1JFS
PDB:
1DBQ
PDB:
1BDI
PDB:
1BDH
PDB:
1QQB
PFAM:
PF00356
PRIDE:
P0ACP7
PRINTS:
PR00036
PRODB:
PRO_000023644
PROSITE:
PS50932
PROSITE:
PS00356
REFSEQ:
NP_416175
SMART:
SM00354
SMR:
P0ACP7
UNIPROT:
P0ACP7


Operon      
Name: purR         
Operon arrangement:
Transcription unit        Promoter
purR


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR, Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1944 1737577 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1945 1737583 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1946 1737585 reverse nd [RS-EPT-CBR] [4]
  promoter ydhBp2 1739809 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp5 1739849 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp1 1739855 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ydhCp6 1739878 forward Similarity to the consensus
Read more >
[ICWHO] [5]



RegulonDB