RegulonDB RegulonDB 10.9: Gene Form
   

pykF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pykF lpp fumD Cra TSS_1983 TSS_1983 TSS_1982 (cluster) TSS_1982 (cluster) TSS_1981 TSS_1981 TSS_1980 TSS_1980 TSS_1979 TSS_1979 lpp lpp lppp2 lppp2 TSS_1977 TSS_1977 TSS_1976 TSS_1976 TSS_1975 TSS_1975 TSS_1974 TSS_1974 TSS_1973 (cluster) TSS_1973 (cluster) TSS_1972 TSS_1972 TSS_1971 TSS_1971 TSS_1970 TSS_1970 TSS_1969 TSS_1969 TSS_1968 TSS_1968 pykFp1 pykFp1 TSS_1967 TSS_1967 TSS_1966 TSS_1966 TSS_1965 (cluster) TSS_1965 (cluster) pykFp3 pykFp3 pykFp2 pykFp2 TSS_1963 TSS_1963 TSS_1962 TSS_1962 TSS_1961 TSS_1961 TSS_1960 (cluster) TSS_1960 (cluster) pykFp pykFp fumDp6 fumDp6 fumDp5 fumDp5 TSS_1959 (cluster) TSS_1959 (cluster)

Gene      
Name: pykF    Texpresso search in the literature
Synonym(s): ECK1672, EG10804, b1676
Genome position(nucleotides): 1755698 --> 1757110 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.89
External database links:  
ASAP:
ABE-0005600
CGSC:
17620
ECHOBASE:
EB0797
ECOLIHUB:
pykF
OU-MICROARRAY:
b1676
STRING:
511145.b1676
COLOMBOS: pykF


Product      
Name: pyruvate kinase I
Synonym(s): PykF
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.729
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
34 -> 37 NFSH
1 -> 342 MKKTKIVCTIGPKTESEEMLAKMLDAGMNVMRLNFSHGDYAEHGQRIQNLRNVMSKTGKTAAILLDTKGPEIRTMKLEGGNDVSLKAGQTFTFTTDKSVIGNSEMVAVTYEGFTTDLSVGNTVLVDDGLIGMEVTAIEGNKVICKVLNNGDLGENKGVNLPGVSIALPALAEKDKQDLIFGCEQGVDFVAASFIRKRSDVIEIREHLKAHGGENIHIISKIENQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCIRARKVVITATQMLDSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLEAVSIMATICERTDRVMNSR
271 -> 271 R
297 -> 297 D
379 -> 379 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.1 - glycolysis
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:1902912 - pyruvate kinase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004743 - pyruvate kinase activity
GO:0000287 - magnesium ion binding
GO:0030955 - potassium ion binding
GO:0042802 - identical protein binding
biological_process GO:0008152 - metabolic process
GO:0006096 - glycolytic process
GO:0009408 - response to heat
GO:0016310 - phosphorylation
External database links:  
DIP:
DIP-36221N
ECOCYC:
PKI-MONOMER
ECOLIWIKI:
b1676
INTERPRO:
IPR011037
INTERPRO:
IPR015795
INTERPRO:
IPR040442
INTERPRO:
IPR036918
INTERPRO:
IPR001697
INTERPRO:
IPR015806
INTERPRO:
IPR015813
INTERPRO:
IPR018209
INTERPRO:
IPR015793
MODBASE:
P0AD61
PANTHER:
PTHR11817
PDB:
4YNG
PDB:
1PKY
PDB:
1E0U
PDB:
1E0T
PFAM:
PF02887
PFAM:
PF00224
PRIDE:
P0AD61
PRINTS:
PR01050
PRODB:
PRO_000023656
PROSITE:
PS00110
REFSEQ:
NP_416191
SMR:
P0AD61
SWISSMODEL:
P0AD61
UNIPROT:
P0AD61


Operon      
Name: pykF         
Operon arrangement:
Transcription unit        Promoter
pykF
pykF
pykF
pykF
pykF
pykF


Transcriptional Regulation      
Display Regulation             
Repressed by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1959 (cluster) 1755165 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter fumDp5 1755167 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter fumDp6 1755209 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1960 (cluster) 1755468 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1961 1755475 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1962 1755528 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1963 1755559 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1965 (cluster) 1755619 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1966 1755627 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1967 1755661 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1968 1755668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1969 1755671 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1970 1755674 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1971 1755742 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1972 1755764 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1973 (cluster) 1756032 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1974 1756122 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1975 1756213 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1976 1756218 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1977 1756232 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1979 1757387 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1980 1757395 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1981 1757425 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1982 (cluster) 1757506 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1983 1757512 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB