RegulonDB RegulonDB 10.9: Gene Form
   

rcsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rcsC atoS rcsB atoC rcsCp4 rcsCp4 rcsCp5 rcsCp5 TSS_2501 TSS_2501 TSS_2500 TSS_2500 TSS_2499 TSS_2499 TSS_2498 TSS_2498 TSS_2497 TSS_2497 TSS_2496 TSS_2496 TSS_2495 TSS_2495 TSS_2494 (cluster) TSS_2494 (cluster) TSS_2493 TSS_2493 TSS_2492 TSS_2492 TSS_2491 TSS_2491

Gene      
Name: rcsC    Texpresso search in the literature
Synonym(s): ECK2211, EG10822, b2218
Genome position(nucleotides): 2317027 <-- 2319876 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.91
External database links:  
ASAP:
ABE-0007336
CGSC:
17974
ECHOBASE:
EB0815
ECOLIHUB:
rcsC
OU-MICROARRAY:
b2218
STRING:
469008.ECD_02145
COLOMBOS: rcsC


Product      
Name: histidine kinase RcsC
Synonym(s): RcsC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol,inner membrane
Molecular weight: 106.506
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
709 -> 799 CWLAVRNASLCQFLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGEWVHSVAAPHELPALLARIY
357 -> 425 QFNRKIVASAPVGICILRTADGVNILSNELAHTYLNMLTHEDRQRLTQIICGQQVNFVDVLTSNNTNLQ
314 -> 335 MLILNAILLNVLAGAALFTLAR
479 -> 479 H
469 -> 533 SKSMFLATVSHELRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIES

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.2 - colanic acid (M antigen)
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0018217 - peptidyl-aspartic acid phosphorylation
GO:0006355 - regulation of transcription, DNA-templated
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0044010 - single-species biofilm formation
GO:0071470 - cellular response to osmotic stress
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Chen MH., et al., 2001
[2] Clavel T., et al., 1996
[3] Hersch SJ., et al., 2020
[4] Huang YH., et al., 2006
[5] Huang YH., et al., 2009
[6] Lee SH., et al., 1996
[7] Majdalani N., et al., 2005
[8] Mouslim C., et al., 2003
[9] Sato T., et al., 2017
[10] Yamamoto K., et al., 2005
[11] Zhou L., et al., 2003
External database links:  
ECOCYC:
RCSC-MONOMER
ECOLIWIKI:
b2218
INTERPRO:
IPR030856
INTERPRO:
IPR036097
INTERPRO:
IPR036890
INTERPRO:
IPR038388
INTERPRO:
IPR019017
INTERPRO:
IPR001789
INTERPRO:
IPR003594
INTERPRO:
IPR003661
INTERPRO:
IPR004358
INTERPRO:
IPR005467
INTERPRO:
IPR011006
MODBASE:
P14376
PDB:
2AYZ
PDB:
2AYY
PDB:
2AYX
PFAM:
PF09456
PFAM:
PF02518
PFAM:
PF00512
PFAM:
PF00072
PRIDE:
P0DMC5
PRINTS:
PR00344
PRODB:
PRO_000023691
PROSITE:
PS51426
PROSITE:
PS50110
PROSITE:
PS50109
REFSEQ:
NP_416722
SMART:
SM00387
SMART:
SM00388
SMART:
SM00448
SMR:
P0DMC5
UNIPROT:
P0DMC5


Operon      
Name: rcsC         
Operon arrangement:
Transcription unit        Promoter
rcsC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2491 2316181 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2492 2316184 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2493 2316190 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2494 (cluster) 2316194 forward For this promoter, there
Read more >
[RS-EPT-CBR] [12]
  promoter TSS_2495 2316231 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2496 2316287 forward nd [RS-EPT-CBR] [12]
  promoter TSS_2497 2317398 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2498 2317454 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2499 2319113 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2500 2319298 reverse nd [RS-EPT-CBR] [12]
  promoter TSS_2501 2319911 reverse nd [RS-EPT-CBR] [12]
  promoter rcsCp5 2319979 reverse Similarity to the consensus
Read more >
[ICWHO] [13]
  promoter rcsCp4 2320081 reverse Similarity to the consensus
Read more >
[ICWHO] [13]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chen MH., Takeda S., Yamada H., Ishii Y., Yamashino T., Mizuno T., 2001, Characterization of the RcsC-->YojN-->RcsB phosphorelay signaling pathway involved in capsular synthesis in Escherichia coli., Biosci Biotechnol Biochem 65(10):2364-7

 [2] Clavel T., Lazzaroni JC., Vianney A., Portalier R., 1996, Expression of the tolQRA genes of Escherichia coli K-12 is controlled by the RcsC sensor protein involved in capsule synthesis., Mol Microbiol 19(1):19-25

 [3] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol 5(5):706-714

 [4] Huang YH., Ferrieres L., Clarke DJ., 2006, The role of the Rcs phosphorelay in Enterobacteriaceae., Res Microbiol 157(3):206-12

 [5] Huang YH., Ferrieres L., Clarke DJ., 2009, Comparative functional analysis of the RcsC sensor kinase from different Enterobacteriaceae., FEMS Microbiol Lett 293(2):248-54

 [6] Lee SH., Kim IC., Lee WS., Byun SM., 1996, RcsC-mediated induction of colanic acid by secretion of streptokinase in Escherichia coli K-12., FEMS Microbiol Lett 139(2-3):189-93

 [7] Majdalani N., Gottesman S., 2005, The Rcs phosphorelay: a complex signal transduction system., Annu Rev Microbiol 59:379-405

 [8] Mouslim C., Latifi T., Groisman EA., 2003, Signal-dependent requirement for the co-activator protein RcsA in transcription of the RcsB-regulated ugd gene., J Biol Chem 278(50):50588-95

 [9] Sato T., Takano A., Hori N., Izawa T., Eda T., Sato K., Umekawa M., Miyagawa H., Muramatsu-Fujishiro A., Matsumoto K., Matsuoka S., Hara H., 2017, Role of the inner-membrane histidine kinase RcsC and outer-membrane lipoprotein RcsF in the activation of the Rcs phosphorelay signal transduction system in Escherichia coli., Microbiology 163(7):1071-1080

 [10] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56

 [11] Zhou L., Lei XH., Bochner BR., Wanner BL., 2003, Phenotype microarray analysis of Escherichia coli K-12 mutants with deletions of all two-component systems., J Bacteriol 185(16):4956-72

 [12] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [13] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB