RegulonDB RegulonDB 10.9: Gene Form
   

recE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recE recT racC ralR rcbA ralA

Gene      
Name: recE    Texpresso search in the literature
Synonym(s): ECK1347, EG10827, b1350, rac, rmuB, sbcA
Genome position(nucleotides): 1414786 <-- 1417386 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.4
External database links:  
ASAP:
ABE-0004531
CGSC:
309
ECHOBASE:
EB0820
ECOLIHUB:
recE
OU-MICROARRAY:
b1350
STRING:
511145.b1350
COLOMBOS: recE


Product      
Name: Rac prophage; exonuclease VIII, ds DNA exonuclease, 5' --> 3' specific
Synonym(s): Rac, RecE, RmuB, SbcA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 96.368
Isoelectric point: 4.431
Motif(s):
 
Type Positions Sequence
2 -> 178 STKPLFLLRKAKKSSGEPDVVLWASNDFESTCATLDYLIVKSGKKLSSYFKAVATNFPVVNDLPAEGEIDFTWSERYQLSKDSMTWELKPGAAPDNAHYQGNTNVNGEDMTEIEENMLLPISGQELPIRWLAQHGSEKPVTHVSRDGLQALHIARAEELPAVTALAVSHKTSLLDPL
615 -> 850 SKSQLDDIADTPALYLWRKNAPVDTTKTKTLDLGTAFHCRVLEPEEFSNRFIVAPEFNRRTNAGKEEEKAFLMECASTGKTVITAEEGRKIELMYQSVMALPLGQWLVESAGHAESSIYWEDPETGILCRCRPDKIIPEFHWIMDVKTTADIQRFKTAYYDYRYHVQDAFYSDGYEAQFGVQPTFVFLVASTTIECGRYPVEIFMMGEEAKLAGQQEYHRNLRTLSDCLNTDEWPA
691 -> 692 ST
366 -> 366 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
molecular_function GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0016787 - hydrolase activity
GO:0042802 - identical protein binding
GO:0051908 - double-stranded DNA 5'-3' exodeoxyribonuclease activity
biological_process GO:0006259 - DNA metabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Kingston AW., et al., 2017
External database links:  
DIP:
DIP-10652N
ECOCYC:
EG10827-MONOMER
ECOLIWIKI:
b1350
INTERPRO:
IPR010584
INTERPRO:
IPR024432
PDB:
3H4R
PFAM:
PF12684
PFAM:
PF06630
PRIDE:
P15032
PRODB:
PRO_000023700
REFSEQ:
NP_415866
SMR:
P15032
UNIPROT:
P15032


Operon      
Name: recET-ralR-rcbA-xisR-intR         
Operon arrangement:
Transcription unit        Promoter
recET-ralR-rcbA-xisR-intR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Kingston AW., Ponkratz C., Raleigh EA., 2017, Rpn (YhgA-Like) Proteins of Escherichia coli K-12 and Their Contribution to RecA-Independent Horizontal Transfer., J Bacteriol 199(7)


RegulonDB