RegulonDB RegulonDB 10.9: Gene Form
   

recR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dnaX htpG recR ybaB AscG Cis-reg; frameshift_element anti-terminator anti-anti-terminator TSS_640 TSS_640 htpGp2 htpGp2 TSS_639 TSS_639 TSS_638 TSS_638 htpGp1 htpGp1 htpGp3 htpGp3 TSS_637 (cluster) TSS_637 (cluster) TSS_636 TSS_636 TSS_635 (cluster) TSS_635 (cluster) ybaBp ybaBp TSS_634 TSS_634 TSS_633 TSS_633

Gene      
Name: recR    Texpresso search in the literature
Synonym(s): ECK0466, EG10834, b0472
Genome position(nucleotides): 494405 --> 495010 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.76
External database links:  
ASAP:
ABE-0001638
CGSC:
31049
ECHOBASE:
EB0827
ECOLIHUB:
recR
OU-MICROARRAY:
b0472
STRING:
511145.b0472
COLOMBOS: recR


Product      
Name: DNA repair protein RecR
Synonym(s): RecR
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.963
Isoelectric point: 4.914
Motif(s):
 
Type Positions Sequence
57 -> 72 CADCRTFTEQEVCNIC
32 -> 32 L
41 -> 77 MRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRR
81 -> 176 GQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVP
82 -> 172 QICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0009411 - response to UV
GO:0000731 - DNA synthesis involved in DNA repair
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-341N
ECOCYC:
EG10834-MONOMER
ECOLIWIKI:
b0472
INTERPRO:
IPR034137
INTERPRO:
IPR023628
INTERPRO:
IPR000093
INTERPRO:
IPR006171
INTERPRO:
IPR015967
INTERPRO:
IPR023627
MODBASE:
P0A7H6
PANTHER:
PTHR30446
PFAM:
PF13662
PFAM:
PF02132
PRIDE:
P0A7H6
PRODB:
PRO_000023707
PROSITE:
PS50880
PROSITE:
PS01300
REFSEQ:
NP_415005
SMART:
SM00493
SMR:
P0A7H6
SWISSMODEL:
P0A7H6
UNIPROT:
P0A7H6


Operon      
Name: ybaB-recR         
Operon arrangement:
Transcription unit        Promoter
ybaB-recR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_633 493064 forward nd [RS-EPT-CBR] [1]
  promoter TSS_634 493071 forward nd [RS-EPT-CBR] [1]
  promoter TSS_635 (cluster) 493804 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_636 494018 forward nd [RS-EPT-CBR] [1]
  promoter TSS_637 (cluster) 494051 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_638 495076 forward nd [RS-EPT-CBR] [1]
  promoter TSS_639 495082 forward nd [RS-EPT-CBR] [1]
  promoter TSS_640 495090 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB