RegulonDB RegulonDB 10.9: Gene Form
   

relB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: relB    Texpresso search in the literature
Synonym(s): ECK1558, EG10836, RC, b1564
Genome position(nucleotides): 1645633 <-- 1645872 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.08
External database links:  
ASAP:
ABE-0005224
CGSC:
305
ECHOBASE:
EB0829
ECOLIHUB:
relB
OU-MICROARRAY:
b1564
STRING:
511145.b1564
COLOMBOS: relB


Product      
Name: Qin prophage; antitoxin/DNA-binding transcriptional repressor RelB
Synonym(s): Qin prophage, antitoxin RelB, Qin prophage, antitoxin of the RelE-RelB toxin-antitoxin system and DNA binding transcriptional repressor RelB, RelB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: RelB, RelE
Cellular location: cytosol
Molecular weight: 9.071
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence
1 -> 78 MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDE
7 -> 7 R
45 -> 45 P
13 -> 13 K
8 -> 8 I

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-48258N
ECOCYC:
EG10836-MONOMER
ECOLIWIKI:
b1564
INTERPRO:
IPR013321
INTERPRO:
IPR007337
PANTHER:
PTHR38781
PDB:
2K29
PDB:
2KC8
PDB:
4FXE
PFAM:
PF04221
PRIDE:
P0C079
PRODB:
PRO_000023711
REFSEQ:
NP_416082
SMR:
P0C079
UNIPROT:
P0C079


Operon      
Name: relBE-hokD         
Operon arrangement:
Transcription unit        Promoter
relBE-hokD
hokD
relBE


Transcriptional Regulation      
Display Regulation             
Repressed by: RelB, RelB-RelE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1865 1645901 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1866 1646073 reverse nd [RS-EPT-CBR] [1]



RegulonDB