RegulonDB RegulonDB 10.9: Gene Form
   

fliD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: fliD    Texpresso search in the literature
Synonym(s): ECK1923, EG10841, b1924, flbC, rfs
Genome position(nucleotides): 2003872 --> 2005278 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.24
External database links:  
ASAP:
ABE-0006407
CGSC:
748
ECHOBASE:
EB0834
ECOLIHUB:
fliD
OU-MICROARRAY:
b1924
STRING:
511145.b1924
COLOMBOS: fliD


Shine dalgarno      
Sequence: cgaaagataaAAGGAAatcgcATG


Product      
Name: flagellar filament capping protein
Synonym(s): FlbC, FliD, HAP2, Rfs, hook-associated protein 2
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,cell projection
Molecular weight: 48.456
Isoelectric point: 4.635
Motif(s):
 
Type Positions Sequence
222 -> 452 AQNAQLTVNNVAIENSSNTISDALENITLNLNDVTTGNQTLTITQDTSKAQTAIKDWVNAYNSLIDTFSSLTKYTAVDAGADSQSSSNGALLGDSTLRTIQTQLKSMLSNTVSSSSYKTLAQIGITTDPSDGKLELDADKLTAALKKDASGVGALIVGDGKKTGITTTIGSNLTSWLSTTGIIKAATDGVSKTLNKLTKDYNAASDRIDAQVARYKEQFTQLDVLMTSLNS
2 -> 468 ASISSLGVGSGLDLSSILDSLTAAQKATLTPISNQQSSFTAKLSAYGTLKSALTTFQTANTALSKADLFSATSTTSSTTAFSATTAGNAIAGKYTISVTHLAQAQTLTTRTTRDDTKTAIATSDSKLTIQQGGDKDPITIDISAANSSLSGIRDAINNAKAGVSASIINVGNGEYRLSVTSNDTGLDNAMTLSVSGDDALQSFMGYDASASSNGMEVSVAAQNAQLTVNNVAIENSSNTISDALENITLNLNDVTTGNQTLTITQDTSKAQTAIKDWVNAYNSLIDTFSSLTKYTAVDAGADSQSSSNGALLGDSTLRTIQTQLKSMLSNTVSSSSYKTLAQIGITTDPSDGKLELDADKLTAALKKDASGVGALIVGDGKKTGITTTIGSNLTSWLSTTGIIKAATDGVSKTLNKLTKDYNAASDRIDAQVARYKEQFTQLDVLMTSLNSTSSYLTQQFENNSNSK
11 -> 106 SGLDLSSILDSLTAAQKATLTPISNQQSSFTAKLSAYGTLKSALTTFQTANTALSKADLFSATSTTSSTTAFSATTAGNAIAGKYTISVTHLAQAQ
114 -> 114 R

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.12 - flagellum
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0005576 - extracellular region
GO:0009288 - bacterial-type flagellum
GO:0009424 - bacterial-type flagellum hook
GO:0009421 - bacterial-type flagellum filament cap
molecular_function GO:0005515 - protein binding
biological_process GO:0007155 - cell adhesion
GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Juhas M., et al., 2014
[2] Song WS., et al., 2017
External database links:  
ECOCYC:
EG10841-MONOMER
ECOLIWIKI:
b1924
INTERPRO:
IPR040026
INTERPRO:
IPR010809
INTERPRO:
IPR003481
PANTHER:
PTHR30288
PDB:
5H5W
PDB:
5H5V
PFAM:
PF02465
PFAM:
PF07195
PRIDE:
P24216
PRODB:
PRO_000022656
REFSEQ:
NP_416434
SMR:
P24216
UNIPROT:
P24216


Operon      
Name: fliDST         
Operon arrangement:
Transcription unit        Promoter
fliDST
fliDST


Transcriptional Regulation      
Display Regulation             
Activated by: FlhDC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2261 2002392 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2262 2002401 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2263 2003300 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2264 2003675 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_2265 2003836 forward nd [RS-EPT-CBR] [3]



RegulonDB