RegulonDB RegulonDB 11.1: Gene Form
   

rhsC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhsC ybfO ybfB unknown ybfA ybfC terminator anti-terminator anti-anti-terminator TSS_831 TSS_831 rhsCp3 rhsCp3

Gene      
Name: rhsC    Texpresso search in the literature
Synonym(s): ECK0689, EG10848, b0700
Genome position(nucleotides): 729583 --> 733776
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
59.16
External database links:  
ASAP:
ABE-0002392
ECHOBASE:
EB0841
ECOLIHUB:
rhsC
OU-MICROARRAY:
b0700
STRING:
511145.b0700
COLOMBOS: rhsC


Product      
Name: rhs element protein RhsC
Synonym(s): RhsC
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 157.776
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence Comment
46 -> 123 GHPVNPLLGAKVLPGETDIALPGPLPFILSRTYSSYRTKTPAPVGSLGPGWKMPADIRLQLRDNTLILSDNGGRSLYF
330 -> 352 NTQVRSFTYDDKYRGRMVAHRHT UniProt: 1.
353 -> 374 GRPEICYRYDSDGRVTEQLNPA UniProt: 2.
361 -> 391 YDSDGRVTEQLNPAGLSYTYQYEKDRITITD
375 -> 417 GLSYTYQYEKDRITITDSLNRREVLHTQGEGGLKRVVKKEHAD UniProt: 3.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Lin RJ., et al., 1984
External database links:  
ALPHAFOLD:
P16918
DIP:
DIP-10701N
ECOCYC:
EG10848-MONOMER
ECOLIWIKI:
b0700
INTERPRO:
IPR022385
INTERPRO:
IPR031325
INTERPRO:
IPR006530
INTERPRO:
IPR001826
PFAM:
PF05593
PFAM:
PF20148
PFAM:
PF03527
PRIDE:
P16918
PRINTS:
PR00394
PRODB:
PRO_000023745
REFSEQ:
NP_415229
SMR:
P16918
UNIPROT:
P16918


Operon      
Name: rhsC-ybfB         
Operon arrangement:
Transcription unit        Promoter
rhsC-ybfB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rhsCp3 729379 forward nd [COMP-AINF] [2]
  promoter TSS_831 734988 forward nd [RS-EPT-CBR] [3]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lin RJ., Capage M., Hill CW., 1984, A repetitive DNA sequence, rhs, responsible for duplications within the Escherichia coli K-12 chromosome., J Mol Biol 177(1):1-18

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB