RegulonDB RegulonDB 10.9: Gene Form
   

rimJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mdtH yceH rimJ ppGpp terminator yceMp4 yceMp4 yceHp2 yceHp2 yceHp4 yceHp4 rimJp rimJp TSS_1339 TSS_1339 TSS_1338 TSS_1338

Gene      
Name: rimJ    Texpresso search in the literature
Synonym(s): ECK1051, EG10851, b1066, tcp
Genome position(nucleotides): 1125562 --> 1126146 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.4
External database links:  
ASAP:
ABE-0003622
CGSC:
276
ECHOBASE:
EB0844
ECOLIHUB:
rimJ
OU-MICROARRAY:
b1066
STRING:
511145.b1066
COLOMBOS: rimJ


Product      
Name: ribosomal-protein-S5-alanine N-acetyltransferase
Synonym(s): RimJ, Tcp
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 22.688
Isoelectric point: 9.428
Motif(s):
 
Type Positions Sequence
105 -> 105 C
17 -> 162 RLVVRLVHDRDAWRLADYYAENRHFLKPWEPVRDESHCYPSGWQARLGMINEFHKQGSAFYFGLFDPDEKEIIGVANFSNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGDLLARLGFE
18 -> 188 LVVRLVHDRDAWRLADYYAENRHFLKPWEPVRDESHCYPSGWQARLGMINEFHKQGSAFYFGLFDPDEKEIIGVANFSNVVRGSFHACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTALTTP
54 -> 54 C

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008999 - ribosomal-protein-alanine N-acetyltransferase activity
GO:1990189 - peptide-serine-N-acetyltransferase activity
GO:1990275 - preribosome binding
biological_process GO:0006464 - cellular protein modification process
GO:0006474 - N-terminal protein amino acid acetylation
GO:0017189 - N-terminal peptidyl-alanine acetylation
GO:0017198 - N-terminal peptidyl-serine acetylation
GO:0042254 - ribosome biogenesis
GO:0030490 - maturation of SSU-rRNA
Note(s): Note(s): ...[more].
Reference(s): [1] Bernal-Perez LF., et al., 2012
[2] Fang H., et al., 2009
[3] Janda I., et al., 1985
[4] Li H., et al., 2017
[5] Zhang S., et al., 2018
External database links:  
DIP:
DIP-35985N
ECOCYC:
EG10851-MONOMER
ECOLIWIKI:
b1066
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P0A948
PFAM:
PF13302
PRIDE:
P0A948
PRODB:
PRO_000023759
PROSITE:
PS51186
REFSEQ:
NP_415584
SMR:
P0A948
UNIPROT:
P0A948


Operon      
Name: rimJ         
Operon arrangement:
Transcription unit        Promoter
rimJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1338 1125354 reverse nd [RS-EPT-CBR] [6]
  promoter TSS_1339 1125475 forward nd [RS-EPT-CBR] [6]
  promoter yceHp4 1126077 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yceHp2 1126081 forward Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter yceMp4 1126604 forward Similarity to the consensus
Read more >
[ICWHO] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bernal-Perez LF., Sahyouni F., Prokai L., Ryu Y., 2012, RimJ-mediated context-dependent N-terminal acetylation of the recombinant Z-domain protein in Escherichia coli., Mol Biosyst 8(4):1128-30

 [2] Fang H., Zhang X., Shen L., Si X., Ren Y., Dai H., Li S., Zhou C., Chen H., 2009, RimJ is responsible for N(alpha)-acetylation of thymosin alpha1 in Escherichia coli., Appl Microbiol Biotechnol 84(1):99-104

 [3] Janda I., Kitakawa M., Isono K., 1985, Gene rpmF for ribosomal protein L32 and gene rimJ for a ribosomal protein acetylating enzyme are located near pyrC (23.4 min) in Escherichia coli., Mol Gen Genet 201(3):433-6

 [4] Li H., Wang T., Sun S., Liu J., Chen J., 2017, Production of Nα -acetyl Tα1-HSA through in vitro acetylation by RimJ., Oncotarget 8(56):95247-95255

 [5] Zhang S., Wunier W., Yao Y., Morigen M., 2018, Defects in ribosome function delay the initiation of chromosome replication in Escherichia coli., J Basic Microbiol

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB