RegulonDB RegulonDB 11.0: Gene Form
   

rlpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dacA mrdB rlpA TSS_758 TSS_758 TSS_757 TSS_757 rlpAp5 rlpAp5 rlpAp7 rlpAp7 dacAp3 dacAp3 dacAp2 dacAp2

Gene      
Name: rlpA    Texpresso search in the literature
Synonym(s): ECK0626, EG10854, b0633
Genome position(nucleotides): 664102 <-- 665190
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.3
External database links:  
ASAP:
ABE-0002171
CGSC:
17932
ECHOBASE:
EB0847
ECOLIHUB:
rlpA
OU-MICROARRAY:
b0633
STRING:
511145.b0633
COLOMBOS: rlpA


Product      
Name: rare lipoprotein RlpA
Synonym(s): RlpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,outer membrane
Molecular weight: 37.528
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence Comment
1 -> 17 MRKQWLGICIAAGMLAA
18 -> 362 CTSDDGQQQTVSVPQPAVCNGPIVEISGADPRFEPLNATANQDYQRDGKSYKIVQDPSRFSQAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRIDPIIVAQDGSLSGPGMACTTVAKQTYALPAPPDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPAMVTPQAVSQSASGNFMVQVGAVSDQARAQQYQQQLGQKFGVPGRVTQNGAVWRIQLGPFASKAEASTLQQRLQTEAQLQSFITTAQ UniProt: Endolytic peptidoglycan transglycosylase RlpA.
79 -> 166 QAGLAAIYDAEPGSNLTASGEAFDPTQLTAAHPTLPIPSYARITNLANGRMIVVRINDRGPYGNDRVISLSRAAADRLNTSNNTKVRI
198 -> 276 PDLSGGAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFLGAPTTLAPGVLEGSEPTPAPQPVVTAPSTTPATSPA UniProt: Disordered; Sequence Annotation Type: region of interest.
203 -> 242 GAGTSSVSGPQGDILPVSNSTLKSEDPTGAPVTSSGFLGA UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016829 - lyase activity
GO:0042834 - peptidoglycan binding
GO:0008932 - lytic endotransglycosylase activity
biological_process GO:0000270 - peptidoglycan metabolic process
GO:0043093 - FtsZ-dependent cytokinesis
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Gerding MA., et al., 2009
[2] Rao S., et al., 2020
[3] Yahashiri A., et al., 2015
External database links:  
ALPHAFOLD:
P10100
ECOCYC:
EG10854-MONOMER
ECOLIWIKI:
b0633
INTERPRO:
IPR036680
INTERPRO:
IPR036908
INTERPRO:
IPR034718
INTERPRO:
IPR012997
INTERPRO:
IPR009009
INTERPRO:
IPR007730
PFAM:
PF05036
PFAM:
PF03330
PRIDE:
P10100
PRODB:
PRO_000023775
PROSITE:
PS51724
PROSITE:
PS51257
REFSEQ:
NP_415166
SMR:
P10100
UNIPROT:
P10100


Operon      
Name: rsfS-rlmH-mrdAB-rlpA         
Operon arrangement:
Transcription unit        Promoter
rsfS-rlmH-mrdAB-rlpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dacAp2 663967 reverse nd [ICWHO] [4]
  promoter dacAp3 664001 reverse nd [ICWHO], [RS-EPT-CBR] [4], [5]
  promoter rlpAp7 665213 reverse nd [ICWHO] [4]
  promoter rlpAp5 665222 reverse nd [ICWHO] [4]
  promoter TSS_757 665332 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_758 665461 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gerding MA., Liu B., Bendezu FO., Hale CA., Bernhardt TG., de Boer PA., 2009, Self-enhanced accumulation of FtsN at Division Sites and Roles for Other Proteins with a SPOR domain (DamX, DedD, and RlpA) in Escherichia coli cell constriction., J Bacteriol 191(24):7383-401

 [2] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [3] Yahashiri A., Jorgenson MA., Weiss DS., 2015, Bacterial SPOR domains are recruited to septal peptidoglycan by binding to glycan strands that lack stem peptides., Proc Natl Acad Sci U S A 112(36):11347-52

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB