RegulonDB RegulonDB 10.8: Gene Form
   

lptE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

leuS holA nadD lptE TSS_767 TSS_767 TSS_766 (cluster) TSS_766 (cluster) TSS_765 TSS_765 TSS_764 TSS_764 TSS_763 TSS_763 TSS_762 TSS_762 cobCp6 cobCp6 cobCp7 cobCp7

Gene      
Name: lptE    Texpresso search in the literature
Synonym(s): ECK0634, EG10855, b0641, rlpB
Genome position(nucleotides): 671605 <-- 672186 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0002194
CGSC:
17929
ECHOBASE:
EB0848
OU-MICROARRAY:
b0641
PortEco:
lptE
STRING:
511145.b0641
COLOMBOS: lptE


Product      
Name: lipopolysaccharide assembly protein LptE
Synonym(s): LptE, RlpB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,outer membrane
Molecular weight: 21.357
Isoelectric point: 9.048
Motif(s):
 
Type Positions Sequence
42 -> 159 DPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKL
74 -> 89 SLRLGKVSIAKDTASV
117 -> 117 P
140 -> 157 QDMIVKEMYDRAAEQLIR
19 -> 193 CGWHLRDTTQVPSTMKVMILDSGDPNGPLSRAVRNQLRLNGVELLDKETTRKDVPSLRLGKVSIAKDTASVFRNGQTAEYQMIMTVNATVLIPGRDIYPISAKVFRSFFDNPQMALAKDNEQDMIVKEMYDRAAEQLIRKLPSIRAADIRSDEEQTSTTTDTPATPARVSTTLGN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.3 - lipopolysaccharide
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:1990351 - transporter complex
molecular_function GO:0005515 - protein binding
GO:0001530 - lipopolysaccharide binding
biological_process GO:0015920 - lipopolysaccharide transport
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Brokx SJ., et al., 2004
[2] Wu T., et al., 2006
External database links:  
DIP:
DIP-35987N
ECOCYC:
EG10855-MONOMER
ECOLIWIKI:
b0641
INTERPRO:
IPR007485
PANTHER:
PTHR38098
PDB:
4RH8
PDB:
4RHB
PDB:
4NHR
PFAM:
PF04390
PRIDE:
P0ADC1
PRODB:
PRO_000023117
PROSITE:
PS51257
REFSEQ:
NP_415174
SMR:
P0ADC1
UNIPROT:
P0ADC1


Operon      
Name: leuS-lptE-holA-nadD-cobC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cobCp7 669944 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter cobCp6 670046 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_762 670902 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_763 671450 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_764 673731 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_765 673832 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_766 (cluster) 674050 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_767 674222 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Brokx SJ., Ellison M., Locke T., Bottorff D., Frost L., Weiner JH., 2004, Genome-wide analysis of lipoprotein expression in Escherichia coli MG1655., J Bacteriol 186(10):3254-8

 [2] Wu T., McCandlish AC., Gronenberg LS., Chng SS., Silhavy TJ., Kahne D., 2006, Identification of a protein complex that assembles lipopolysaccharide in the outer membrane of Escherichia coli., Proc Natl Acad Sci U S A 103(31):11754-9

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB