RegulonDB RegulonDB 10.8: Gene Form
   

rna gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rna    Texpresso search in the literature
Synonym(s): ECK0604, EG10856, b0611, rnsA
Genome position(nucleotides): 644197 <-- 645003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.18
External database links:  
ASAP:
ABE-0002107
CGSC:
273
ECHOBASE:
EB0849
OU-MICROARRAY:
b0611
PortEco:
rna
STRING:
511145.b0611
COLOMBOS: rna


Product      
Name: RNase I
Synonym(s): Rna, RnsA, ribonuclease I
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol
Molecular weight: 29.618
Isoelectric point: 8.726
Motif(s):
 
Type Positions Sequence
24 -> 268 LALQAKQYGDFDRYVLALSWQTGFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQGNPAYLTEIQISIKADAINAPLSANSFLPQPHPGNCGKTFVIDKAGY
1 -> 23 MKAFWRNAALLAVSLLPFSSANA
35 -> 235 DRYVLALSWQTGFCQSQHDRNRNERDECRLQTETTNKADFLTVHGLWPGLPKSVAARGVDERRWMRFGCATRPIPNLPEARASRMCSSPETGLSLETAAKLSEVMPGAGGRSCLERYEYAKHGACFGFDPDAYFGTMVRLNQEIKESEAGKFLADNYGKTVSRRDFDAAFAKSWGKENVKAVKLTCQGNPAYLTEIQISIK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.1 - RNA
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0016829 - lyase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
GO:0008847 - Enterobacter ribonuclease activity
GO:0033897 - ribonuclease T2 activity
biological_process GO:0006401 - RNA catabolic process
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10723N
ECOCYC:
EG10856-MONOMER
ECOLIWIKI:
b0611
INTERPRO:
IPR039378
INTERPRO:
IPR036430
INTERPRO:
IPR033130
INTERPRO:
IPR018188
INTERPRO:
IPR001568
MINT:
MINT-1292710
MODBASE:
P21338
PANTHER:
PTHR11240
PDB:
2PQY
PDB:
2Z70
PDB:
2PQX
PDB:
2EA1
PFAM:
PF00445
PRIDE:
P21338
PRODB:
PRO_000023786
PROSITE:
PS00530
PROSITE:
PS00531
REFSEQ:
NP_415144
SMR:
P21338
UNIPROT:
P21338


Operon      
Name: rna         
Operon arrangement:
Transcription unit        Promoter
rna


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rnkp6 644055 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter rnkp7 644180 reverse Similarity to the consensus
Read more >
[ICWHO] [1]



RegulonDB