RegulonDB RegulonDB 10.8: Gene Form
   

rplM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

zapE rplM rpsI CRP Fis DksA-ppGpp DksA-ppGpp TSS_3561 TSS_3561 rplMp rplMp TSS_3560 (cluster) TSS_3560 (cluster) TSS_3559 TSS_3559 TSS_3558 (cluster) TSS_3558 (cluster) rpsIp2 rpsIp2 TSS_3557 TSS_3557 TSS_3556 (cluster) TSS_3556 (cluster)

Gene      
Name: rplM    Texpresso search in the literature
Synonym(s): ECK3220, EG10874, b3231
Genome position(nucleotides): 3378223 <-- 3378651 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.58
External database links:  
ASAP:
ABE-0010599
CGSC:
253
ECHOBASE:
EB0867
OU-MICROARRAY:
b3231
PortEco:
rplM
STRING:
511145.b3231
COLOMBOS: rplM


Product      
Name: 50S ribosomal subunit protein L13
Synonym(s): RplM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,ribosome
Molecular weight: 16.019
Isoelectric point: 10.496
Motif(s):
 
Type Positions Sequence
15 -> 138 WYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNADKVAVTGNKRTDKVYYHHTGHIGGIKQATFEEMIARRPERVIEIAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0003729 - mRNA binding
GO:0008270 - zinc ion binding
GO:0070180 - large ribosomal subunit rRNA binding
biological_process GO:0006412 - translation
GO:0017148 - negative regulation of translation
Note(s): Note(s): ...[more].
Reference(s): [1] Al-Majdoub ZM., et al., 2014
[2] Andrieux E., et al., 1984
[3] Aseev LV., et al., 2016
[4] Dabbs ER. 1982
[5] Gongadze GM., et al., 1986
[6] Isono S., et al., 1985
[7] Kaczanowska M., et al., 2004
[8] Kakegawa T., et al., 1986
[9] Kuroda A., et al., 2001
[10] Maassen JA., et al., 1974
[11] Mende L. 1978
[12] Metaxas A., et al., 2002
[13] Tangy F., et al., 1983
External database links:  
DIP:
DIP-47837N
ECOCYC:
EG10874-MONOMER
ECOLIWIKI:
b3231
INTERPRO:
IPR036899
INTERPRO:
IPR005822
INTERPRO:
IPR005823
INTERPRO:
IPR023563
MINT:
MINT-1269598
MODBASE:
P0AA10
PANTHER:
PTHR11545
PDB:
1ML5
PDB:
2J28
PDB:
2RDO
PDB:
3BBX
PDB:
3IY9
PDB:
3J5L
PDB:
3J7Z
PDB:
3J8G
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4CSU
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4UY8
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5ADY
PDB:
5AFI
PDB:
5AKA
PDB:
5GAD
PDB:
5GAE
PDB:
5GAF
PDB:
5GAG
PDB:
5GAH
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5MGP
PDB:
5NCO
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GBZ
PDB:
6GC0
PDB:
6GC4
PDB:
6GC6
PDB:
6GC7
PDB:
6GC8
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I0Y
PDB:
6I7V
PDB:
6OFX
PDB:
6OG7
PDB:
6Q98
PDB:
6Q9A
PDB:
6QUL
PFAM:
PF00572
PRIDE:
P0AA10
PRODB:
PRO_000023819
PROSITE:
PS00783
REFSEQ:
NP_417698
SMR:
P0AA10
UNIPROT:
P0AA10


Operon      
Name: rplM-rpsI         
Operon arrangement:
Transcription unit        Promoter
rplM-rpsI
 


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, FNR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3556 (cluster) 3378167 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_3557 3378193 reverse nd [RS-EPT-CBR] [14]
  promoter rpsIp2 3378290 reverse Similarity to the consensus
Read more >
[ICWHO] [15]
  promoter TSS_3558 (cluster) 3378644 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_3559 3378647 reverse nd [RS-EPT-CBR] [14]
  promoter TSS_3560 (cluster) 3378671 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [14]
  promoter TSS_3561 3378746 reverse nd [RS-EPT-CBR] [14]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Al-Majdoub ZM., Carroll KM., Gaskell SJ., Barber J., 2014, Quantification of the proteins of the bacterial ribosome using QconCAT technology., J Proteome Res 13(3):1211-22

 [2] Andrieux E., Cozzone AJ., 1984, Conformational changes in bacterial polysomes induced by amino acid starvation., Int J Biochem 16(1):113-6

 [3] Aseev LV., Koledinskaya LS., Boni IV., 2016, Regulation of Ribosomal Protein Operons rplM-rpsI, rpmB-rpmG, and rplU-rpmA at the Transcriptional and Translational Levels., J Bacteriol 198(18):2494-502

 [4] Dabbs ER., 1982, The gene for ribosomal protein L13, rplM, is located near argR, at about 70 minutes on the Escherichia coli chromosomal linkage map., J Bacteriol 149(2):779-82

 [5] Gongadze GM., Selivanova OM., Gudkov AT., Vasiliev VD., 1986, Structure of protein-deficient 50 S ribosomal subunits. Nine core proteins induce the compact conformation of 23 S ribosomal RNA., FEBS Lett 197(1-2):74-8

 [6] Isono S., Thamm S., Kitakawa M., Isono K., 1985, Cloning and nucleotide sequencing of the genes for ribosomal proteins S9 (rpsI) and L13 (rplM) of Escherichia coli., Mol Gen Genet 198(2):279-82

 [7] Kaczanowska M., Ryden-Aulin M., 2004, Temperature sensitivity caused by mutant release factor 1 is suppressed by mutations that affect 16S rRNA maturation., J Bacteriol 186(10):3046-55

 [8] Kakegawa T., Sato E., Hirose S., Igarashi K., 1986, Polyamine binding sites on Escherichia coli ribosomes., Arch Biochem Biophys 251(2):413-20

 [9] Kuroda A., Nomura K., Ohtomo R., Kato J., Ikeda T., Takiguchi N., Ohtake H., Kornberg A., 2001, Role of inorganic polyphosphate in promoting ribosomal protein degradation by the Lon protease in E. coli., Science 293(5530):705-8

 [10] Maassen JA., Moller W., 1974, Identification by photo-affinity labeling of the proteins in Escherichia coli ribosomes involved in elongation factor G-dependent GDP binding., Proc Natl Acad Sci U S A 71(4):1277-80

 [11] Mende L., 1978, The primary structure of protein L13 from the large subunit of Escherichia coli ribosomes., FEBS Lett 96(2):313-6

 [12] Metaxas A., Tzartos S., Liakopoulou-Kyriakide M., 2002, The production of anti-hexapeptide antibodies which recognize the S7, L6 and L13 ribosomal proteins of Escherichia coli., J Pept Sci 8(3):118-24

 [13] Tangy F., Capmau ML., Le Goffic F., 1983, Photo-induced labelling of Escherichia coli ribosomes by a tobramycin analog., Eur J Biochem 131(3):581-7

 [14] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [15] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB