RegulonDB RegulonDB 10.9: Gene Form
   

rpmE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rpmE    Texpresso search in the literature
Synonym(s): ECK3928, EG10889, b3936
Genome position(nucleotides): 4127013 --> 4127225 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.3
External database links:  
ASAP:
ABE-0012867
CGSC:
237
ECHOBASE:
EB0882
ECOLIHUB:
rpmE
OU-MICROARRAY:
b3936
STRING:
511145.b3936
COLOMBOS: rpmE


Product      
Name: 50S ribosomal subunit protein L31
Synonym(s): RpmE
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 7.871
Isoelectric point: 9.867
Motif(s):
 
Type Positions Sequence
1 -> 65 MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFN
37 -> 40 CSKC
18 -> 18 C
16 -> 16 C

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0022625 - cytosolic large ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
GO:0008270 - zinc ion binding
biological_process GO:1904689 - negative regulation of cytoplasmic translational initiation
GO:0006412 - translation
GO:0006413 - translational initiation
Note(s): Note(s): ...[more].
Reference(s): [1] Dabbs ER. 1981
[2] Eckert I., et al., 2020
[3] Mustoe AM., et al., 2018
External database links:  
ECOCYC:
EG10889-MONOMER
ECOLIWIKI:
b3936
INTERPRO:
IPR002150
INTERPRO:
IPR027491
INTERPRO:
IPR042105
INTERPRO:
IPR034704
MODBASE:
P0A7M9
PANTHER:
PTHR33280
PDB:
2J28
PDB:
2RDO
PDB:
3BBX
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
4V4H
PDB:
4V4Q
PDB:
4V5B
PDB:
4V65
PDB:
4V66
PDB:
4V6K
PDB:
4V6L
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6V
PDB:
5AFI
PDB:
5AKA
PDB:
5IQR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5MGP
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6O9J
PDB:
6ORE
PDB:
6OT3
PDB:
6OUO
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF01197
PRIDE:
P0A7M9
PRINTS:
PR01249
PRODB:
PRO_000023836
PROSITE:
PS01143
REFSEQ:
NP_418371
SMR:
P0A7M9
UNIPROT:
P0A7M9


Operon      
Name: rpmE         
Operon arrangement:
Transcription unit        Promoter
rpmE
rpmE


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4640 4126911 forward nd [RS-EPT-CBR] [4]
  promoter TSS_4641 4126913 forward nd [RS-EPT-CBR] [4]



RegulonDB