RegulonDB RegulonDB 10.9: Gene Form
   

rpoA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpoA rpsD rplQ TSS_3651 TSS_3651 TSS_3650 TSS_3650 TSS_3649 TSS_3649 TSS_3648 TSS_3648 TSS_3647 TSS_3647 TSS_3646 TSS_3646 TSS_3645 TSS_3645 TSS_3644 TSS_3644 TSS_3643 TSS_3643 TSS_3642 TSS_3642 TSS_3641 TSS_3641 TSS_3640 TSS_3640 TSS_3639 (cluster) TSS_3639 (cluster) TSS_3638 TSS_3638 TSS_3637 (cluster) TSS_3637 (cluster) TSS_3636 (cluster) TSS_3636 (cluster) TSS_3635 TSS_3635 TSS_3634 TSS_3634 TSS_3633 (cluster) TSS_3633 (cluster) TSS_3632 TSS_3632 TSS_3631 TSS_3631 TSS_3630 TSS_3630 TSS_3629 (cluster) TSS_3629 (cluster) TSS_3628 (cluster) TSS_3628 (cluster) TSS_3627 (cluster) TSS_3627 (cluster) TSS_3626 (cluster) TSS_3626 (cluster) TSS_3625 TSS_3625 TSS_3624 (cluster) TSS_3624 (cluster) TSS_3623 TSS_3623 TSS_3622 (cluster) TSS_3622 (cluster) TSS_3621 TSS_3621 TSS_3620 TSS_3620 TSS_3619 TSS_3619 TSS_3618 TSS_3618 TSS_3617 TSS_3617 TSS_3616 TSS_3616 TSS_3615 TSS_3615 TSS_3614 TSS_3614 TSS_3613 TSS_3613 TSS_3612 TSS_3612 TSS_3611 TSS_3611

Gene      
Name: rpoA    Texpresso search in the literature
Synonym(s): ECK3282, EG10893, b3295, pez, phs, sez
Genome position(nucleotides): 3440040 <-- 3441029 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.22
External database links:  
ASAP:
ABE-0010802
CGSC:
234
ECHOBASE:
EB0886
ECOLIHUB:
rpoA
OU-MICROARRAY:
b3295
STRING:
511145.b3295
COLOMBOS: rpoA


Product      
Name: RNA polymerase subunit α
Synonym(s): Pez, Phs, RpoA, Sez
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.512
Isoelectric point: 4.698
Motif(s):
 
Type Positions Sequence
45 -> 45 R
162 -> 165 EEDE
208 -> 208 N
165 -> 165 E
60 -> 156 EIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENASISMRIKVQRGRGYVPAS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003899 - DNA-directed 5'-3' RNA polymerase activity
GO:0046983 - protein dimerization activity
biological_process GO:0006351 - transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35879N
ECOCYC:
EG10893-MONOMER
ECOLIWIKI:
b3295
INTERPRO:
IPR011260
INTERPRO:
IPR011262
INTERPRO:
IPR036643
INTERPRO:
IPR011773
INTERPRO:
IPR036603
INTERPRO:
IPR011263
MINT:
P0A7Z4
MODBASE:
P0A7Z4
PDB:
6GH6
PDB:
6JBQ
PDB:
6JNX
PDB:
6K4Y
PDB:
6KJ6
PDB:
6N57
PDB:
6N58
PDB:
6N60
PDB:
6N61
PDB:
6OMF
PDB:
6P18
PDB:
6P19
PDB:
6P1K
PDB:
6PSQ
PDB:
6PSR
PDB:
6PSS
PDB:
6PST
PDB:
6PSU
PDB:
6PSV
PDB:
6PSW
PDB:
6R9B
PDB:
6R9G
PDB:
6RH3
PDB:
6RI7
PDB:
6RI9
PDB:
6RIN
PDB:
6RIP
PDB:
6WR6
PDB:
1BDF
PDB:
1COO
PDB:
1LB2
PDB:
1XS9
PDB:
3IYD
PDB:
3K4G
PDB:
3LU0
PDB:
3N4M
PDB:
3N97
PDB:
4JK1
PDB:
4JK2
PDB:
4KMU
PDB:
4KN4
PDB:
4KN7
PDB:
4MEX
PDB:
4MEY
PDB:
4S20
PDB:
4XSX
PDB:
4XSY
PDB:
4XSZ
PDB:
4YG2
PDB:
4YLN
PDB:
4YLO
PDB:
4YLP
PDB:
4ZH2
PDB:
4ZH3
PDB:
4ZH4
PDB:
5BYH
PDB:
5CIZ
PDB:
5EZK
PDB:
5IPL
PDB:
5IPM
PDB:
5IPN
PDB:
5MS0
PDB:
5MY1
PDB:
5NSR
PDB:
5NSS
PDB:
5NWT
PDB:
5UAC
PDB:
5UAG
PDB:
5UAH
PDB:
5UAJ
PDB:
5UAL
PDB:
5UAQ
PDB:
5VSW
PDB:
5VT0
PDB:
5W1S
PDB:
5W1T
PDB:
6ALF
PDB:
6ALG
PDB:
6ALH
PDB:
6ASX
PDB:
6BJS
PDB:
6BYU
PDB:
6C6S
PDB:
6C6T
PDB:
6C6U
PDB:
6C9Y
PDB:
6CA0
PDB:
6CUX
PDB:
6FLP
PDB:
6FLQ
PDB:
6GFW
PDB:
6GH5
PFAM:
PF01000
PFAM:
PF01193
PFAM:
PF03118
PRIDE:
P0A7Z4
PRODB:
PRO_000023844
REFSEQ:
NP_417754
SMART:
SM00662
SMR:
P0A7Z4
UNIPROT:
P0A7Z4


Operon      
Name: rpsMKD-rpoA-rplQ         
Operon arrangement:
Transcription unit        Promoter
rpsMKD-rpoA-rplQ
rpsMKD-rpoA-rplQ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3611 3439845 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3612 3439858 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3613 3439992 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3614 3439994 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3615 3440198 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3616 3440200 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3617 3440202 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3618 3440207 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3619 3440256 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3620 3440528 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3621 3440670 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3622 (cluster) 3440696 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3623 3440698 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3624 (cluster) 3441009 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3625 3441034 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3626 (cluster) 3441039 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3627 (cluster) 3441042 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3628 (cluster) 3441047 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3629 (cluster) 3441078 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3630 3441080 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3631 3441085 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3632 3441141 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3633 (cluster) 3441144 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3634 3441149 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3635 3441154 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3636 (cluster) 3441158 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3637 (cluster) 3441166 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3638 3441370 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3639 (cluster) 3441375 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_3640 3441422 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3641 3441432 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3642 3441447 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3643 3441449 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3644 3441486 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3645 3441492 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3646 3441494 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3647 3441505 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3648 3441526 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3649 3441571 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3650 3441576 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3651 3441665 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB