RegulonDB RegulonDB 10.8: Gene Form
   

rpoZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rpoZ    Texpresso search in the literature
Synonym(s): ECK3639, EG10899, b3649, spoS
Genome position(nucleotides): 3822106 --> 3822381 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0011933
CGSC:
28445
ECHOBASE:
EB0892
OU-MICROARRAY:
b3649
PortEco:
rpoZ
STRING:
511145.b3649
COLOMBOS: rpoZ


Product      
Name: RNA polymerase subunit ω
Synonym(s): RpoZ, SpoS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.237
Isoelectric point: 4.571
Motif(s):
 
Type Positions Sequence
10 -> 59 VEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLI
2 -> 91 ARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030880 - RNA polymerase complex
molecular_function GO:0003677 - DNA binding
GO:0016779 - nucleotidyltransferase activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0003899 - DNA-directed 5'-3' RNA polymerase activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0065003 - protein-containing complex assembly
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Gentry DR., et al., 1989
[2] Gentry DR., et al., 1986
External database links:  
DIP:
DIP-31837N
ECOCYC:
EG10899-MONOMER
ECOLIWIKI:
b3649
INTERPRO:
IPR003716
INTERPRO:
IPR036161
INTERPRO:
IPR012293
INTERPRO:
IPR006110
MINT:
MINT-1222720
PANTHER:
PTHR34476
PDB:
6RI9
PDB:
6RIN
PDB:
6RIP
PDB:
3IYD
PDB:
3LU0
PDB:
4JK1
PDB:
4JK2
PDB:
4KMU
PDB:
4KN4
PDB:
4KN7
PDB:
4MEX
PDB:
4MEY
PDB:
4XSX
PDB:
4XSY
PDB:
4XSZ
PDB:
4YG2
PDB:
4YLN
PDB:
4YLO
PDB:
4YLP
PDB:
4ZH2
PDB:
4ZH3
PDB:
4ZH4
PDB:
5BYH
PDB:
5EZK
PDB:
5IPL
PDB:
5IPM
PDB:
5IPN
PDB:
5MS0
PDB:
5MY1
PDB:
5NSR
PDB:
5NSS
PDB:
5NWT
PDB:
5UAC
PDB:
5UAG
PDB:
5UAH
PDB:
5UAJ
PDB:
5UAL
PDB:
5UAQ
PDB:
5VSW
PDB:
5VT0
PDB:
5W1S
PDB:
5W1T
PDB:
6ALF
PDB:
6ALG
PDB:
6ALH
PDB:
6ASX
PDB:
6BJS
PDB:
6BYU
PDB:
6C6S
PDB:
6C6T
PDB:
6C6U
PDB:
6C9Y
PDB:
6CA0
PDB:
6CUX
PDB:
6FLP
PDB:
6FLQ
PDB:
6GFW
PDB:
6GH5
PDB:
6GH6
PDB:
6JBQ
PDB:
6JNX
PDB:
6K4Y
PDB:
6N60
PDB:
6N61
PDB:
6P18
PDB:
6P19
PDB:
6RI7
PFAM:
PF01192
PRIDE:
P0A800
PRODB:
PRO_000023852
REFSEQ:
NP_418106
SMART:
SM01409
SMR:
P0A800
UNIPROT:
P0A800


Operon      
Name: rpoZ-spoT-trmH-recG         
Operon arrangement:
Transcription unit        Promoter
rpoZ-spoT-trmH-recG
recG


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4228 3821861 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4229 (cluster) 3821923 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4230 (cluster) 3821985 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4231 3822034 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4232 (cluster) 3822036 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4233 3822040 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4235 3822245 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4236 (cluster) 3822249 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4237 3823562 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4238 (cluster) 3823568 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4239 3823619 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4240 3824410 forward nd [RS-EPT-CBR] [3]



RegulonDB