RegulonDB RegulonDB 10.8: Gene Form
   

rpsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: rpsA    Texpresso search in the literature
Synonym(s): ECK0902, EG10900, b0911, ssyF
Genome position(nucleotides): 961995 --> 963668 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.19
External database links:  
ASAP:
ABE-0003104
CGSC:
230
ECHOBASE:
EB0893
OU-MICROARRAY:
b0911
PortEco:
rpsA
STRING:
511145.b0911
COLOMBOS: rpsA


Product      
Name: 30S ribosomal subunit protein S1
Synonym(s): RpsA, SsyF
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 61.158
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
277 -> 347 GTKLTGRVTNLTDYGCFVEIEEGVEGLVHVSEMDWTNKNIHPSKVVNVGDVVEVMVLDIDEERRRISLGLK
104 -> 171 DAETVTGVINGKVKGGFTVELNGIRAFLPGSLVDVRPVRDTLHLEGKELEFKVIKLDQKRNNVVVSRR
208 -> 208 F
219 -> 219 H
361 -> 434 HNKGDRVEGKIKSITDFGIFIGLDGGIDGLVHLSDISWNVAGEEAVREYKKGDEIAAVVLQVDAERERISLGVK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005840 - ribosome
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003676 - nucleic acid binding
GO:0003735 - structural constituent of ribosome
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
biological_process GO:0006412 - translation
GO:0000028 - ribosomal small subunit assembly
GO:2000766 - negative regulation of cytoplasmic translation
Note(s): Note(s): ...[more].
Reference(s): [1] Duval M., et al., 2013
[2] Osterberg R., et al., 1978
[3] Pan JY., et al., 2011
External database links:  
DIP:
DIP-35884N
ECOCYC:
EG10900-MONOMER
ECOLIWIKI:
b0911
INTERPRO:
IPR000110
INTERPRO:
IPR003029
INTERPRO:
IPR012340
INTERPRO:
IPR022967
MINT:
P0AG67
MODBASE:
P0AG67
PDB:
6H58
PDB:
6H4N
PDB:
6BU8
PDB:
4R71
PDB:
4Q7J
PDB:
2KHJ
PDB:
2KHI
PDB:
2BH8
PDB:
5XQ5
PFAM:
PF00575
PRIDE:
P0AG67
PRINTS:
PR00681
PRODB:
PRO_000023854
PROSITE:
PS50126
REFSEQ:
NP_415431
SMART:
SM00316
SMR:
P0AG67
UNIPROT:
P0AG67


Operon      
Name: cmk-rpsA-ihfB         
Operon arrangement:
Transcription unit        Promoter
cmk-rpsA
rpsA-ihfB
rpsA-ihfB
ihfB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1178 961718 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1179 (cluster) 961893 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1180 961899 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1181 962373 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1182 (cluster) 962813 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1183 962831 forward nd [RS-EPT-CBR] [4]
  promoter TSS_1184 962837 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_1185 (cluster) 963236 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1186 (cluster) 963240 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1187 (cluster) 963362 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_1188 964101 forward nd [RS-EPT-CBR] [4]
  promoter ycaIp6 964105 forward Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter ycaIp8 964108 forward Similarity to the consensus
Read more >
[ICWHO] [5]



RegulonDB