RegulonDB RegulonDB 10.8: Gene Form
   

rpsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tsf rpsB tff terminator anti-terminator anti-anti-terminator anti-anti-terminator terminator TSS_325 TSS_325 TSS_324 TSS_324 TSS_323 TSS_323 TSS_322 TSS_322 TSS_321 TSS_321 TSS_320 TSS_320 TSS_319 (cluster) TSS_319 (cluster) TSS_318 TSS_318 TSS_317 TSS_317 rpsBp rpsBp

Gene      
Name: rpsB    Texpresso search in the literature
Synonym(s): ECK0168, EG10901, b0169
Genome position(nucleotides): 189874 --> 190599 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.38
External database links:  
ASAP:
ABE-0000575
CGSC:
229
ECHOBASE:
EB0894
OU-MICROARRAY:
b0169
PortEco:
rpsB
STRING:
511145.b0169
COLOMBOS: rpsB


Product      
Name: 30S ribosomal subunit protein S2
Synonym(s): RpsB
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome
Molecular weight: 26.744
Isoelectric point: 7.161
Motif(s):
 
Type Positions Sequence
2 -> 241 ATVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQDLASQAEESFVEAE
9 -> 224 MLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKDAALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDALFVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005840 - ribosome
GO:0015935 - small ribosomal subunit
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0005515 - protein binding
GO:0008270 - zinc ion binding
biological_process GO:0006412 - translation
GO:0000028 - ribosomal small subunit assembly
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-6877N
ECOCYC:
EG10901-MONOMER
ECOLIWIKI:
b0169
INTERPRO:
IPR001865
INTERPRO:
IPR005706
INTERPRO:
IPR018130
INTERPRO:
IPR023591
PANTHER:
PTHR12534
PDB:
1M5G
PDB:
2YKR
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4A2I
PDB:
4ADV
PDB:
4ODL
PDB:
4ODM
PDB:
4ODN
PDB:
4ODP
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5AFI
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5ME0
PDB:
5ME1
PDB:
5MGP
PDB:
5MY1
PDB:
5NO3
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5UZ4
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I7V
PDB:
6OFX
PDB:
6OG7
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PFAM:
PF00318
PRIDE:
P0A7V0
PRINTS:
PR00395
PRODB:
PRO_000023855
PROSITE:
PS00962
PROSITE:
PS00963
REFSEQ:
NP_414711
SMR:
P0A7V0
UNIPROT:
P0A7V0


Operon      
Name: tff-rpsB-tsf         
Operon arrangement:
Transcription unit        Promoter
rpsB-tsf


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_317 190209 forward nd [RS-EPT-CBR] [1]
  promoter TSS_318 190213 forward nd [RS-EPT-CBR] [1]
  promoter TSS_319 (cluster) 190227 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_320 190234 forward nd [RS-EPT-CBR] [1]
  promoter TSS_321 190257 forward nd [RS-EPT-CBR] [1]
  promoter TSS_322 190355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_323 190448 forward nd [RS-EPT-CBR] [1]
  promoter TSS_324 190803 forward nd [RS-EPT-CBR] [1]
  promoter TSS_325 190841 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB