RegulonDB RegulonDB 11.1: Gene Form
   

serA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

serA rpiA sibC ibsC CRP Nac Nac serAp2 serAp2 serAp1 serAp1 TSS_3203 TSS_3203 TSS_3202 (cluster) TSS_3202 (cluster) TSS_3201 TSS_3201 TSS_3200 TSS_3200 TSS_3199 TSS_3199 TSS_3198 TSS_3198 TSS_3197 TSS_3197 TSS_3196 TSS_3196 TSS_3195 TSS_3195 TSS_3194 TSS_3194 TSS_3193 TSS_3193 ibsCp ibsCp

Gene      
Name: serA    Texpresso search in the literature
Synonym(s): ECK2909, EG10944, b2913
Genome position(nucleotides): 3057178 <-- 3058410
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.96
External database links:  
ASAP:
ABE-0009561
CGSC:
173
ECHOBASE:
EB0937
ECOLIHUB:
serA
MIM:
256520
MIM:
601815
OU-MICROARRAY:
b2913
STRING:
511145.b2913
COLOMBOS: serA


Product      
Name: phosphoglycerate dehydrogenase
Synonym(s): SerA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 44.176
Isoelectric point: 6.326
Motif(s):
 
Type Positions Sequence Comment
2 -> 410 AKVSLEKDKIKFLLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVNFPEVSLPLHGGRRLMHIHENRPGVLTALNKIFAEQGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKAIPGTIRARLLY UniProt: D-3-phosphoglycerate dehydrogenase.
14 -> 326 LLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLRSRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEAQENIGLEVAGKLIKYSDNGSTLSAVN
118 -> 294 GELLLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIG
161 -> 162 HI UniProt: NAD.
238 -> 240 ASR UniProt: NAD.

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.11 - serine
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004617 - phosphoglycerate dehydrogenase activity
GO:0047545 - 2-hydroxyglutarate dehydrogenase activity
GO:0030267 - glyoxylate reductase (NADP+) activity
GO:0042802 - identical protein binding
GO:0051287 - NAD binding
GO:0016618 - hydroxypyruvate reductase activity
GO:0070403 - NAD+ binding
GO:0070905 - serine binding
GO:0070404 - NADH binding
biological_process GO:0006564 - L-serine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Burton RL., et al., 2009
[2] Deng H., et al., 2016
[3] Kim HJ., et al., 2013
[4] Li Y., et al., 2012
[5] Mundhada H., et al., 2016
[6] Tobey KL., et al., 1986
External database links:  
ALPHAFOLD:
P0A9T0
DIP:
DIP-10851N
ECOCYC:
PGLYCDEHYDROG-MONOMER
ECOLIWIKI:
b2913
INTERPRO:
IPR029752
INTERPRO:
IPR029753
INTERPRO:
IPR036291
INTERPRO:
IPR006140
INTERPRO:
IPR002912
INTERPRO:
IPR006139
PDB:
2PA3
PDB:
2P9G
PDB:
2P9E
PDB:
2P9C
PDB:
1YBA
PDB:
1PSD
PDB:
1SC6
PFAM:
PF00389
PFAM:
PF02826
PFAM:
PF01842
PRIDE:
P0A9T0
PROSITE:
PS00065
PROSITE:
PS00671
PROSITE:
PS51671
PROSITE:
PS00670
REFSEQ:
NP_417388
SMR:
P0A9T0
UNIPROT:
P0A9T0


Operon      
Name: serA         
Operon arrangement:
Transcription unit        Promoter
serA
serA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, Lrp
Repressed by: Nac, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3193 3057340 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3194 3057467 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3195 3057593 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3196 3057726 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3197 3057734 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3198 3058242 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3199 3058303 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3200 3058379 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3201 3058419 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3202 (cluster) 3058434 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3203 3058455 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burton RL., Chen S., Xu XL., Grant GA., 2009, Transient kinetic analysis of the interaction of L-serine with Escherichia coli D-3-phosphoglycerate dehydrogenase reveals the mechanism of V-type regulation and the order of effector binding., Biochemistry 48(51):12242-51

 [2] Deng H., Chen C., Sun C., Wei C., 2016, [Construction and characterization of Escherichia coli D-3-phosphoglycerate dehydrogenase mutants with feedback-inhibition relief]., Sheng Wu Gong Cheng Xue Bao 32(4):468-477

 [3] Kim HJ., Hou BK., Lee SG., Kim JS., Lee DW., Lee SJ., 2013, Genome-wide analysis of redox reactions reveals metabolic engineering targets for D-lactate overproduction in Escherichia coli., Metab Eng 18:44-52

 [4] Li Y., Chen GK., Tong XW., Zhang HT., Liu XG., Liu YH., Lu FP., 2012, Construction of Escherichia coli strains producing L-serine from glucose., Biotechnol Lett 34(8):1525-30

 [5] Mundhada H., Schneider K., Christensen HB., Nielsen AT., 2016, Engineering of high yield production of L-serine in Escherichia coli., Biotechnol Bioeng 113(4):807-16

 [6] Tobey KL., Grant GA., 1986, The nucleotide sequence of the serA gene of Escherichia coli and the amino acid sequence of the encoded protein, D-3-phosphoglycerate dehydrogenase., J Biol Chem 261(26):12179-83

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB