RegulonDB RegulonDB 11.0: Gene Form
   

srlB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srlE srlD srlB srlA

Gene      
Name: srlB    Texpresso search in the literature
Synonym(s): ECK2699, EG10970, b2704, gutB
Genome position(nucleotides): 2827362 --> 2827733
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.11
External database links:  
ASAP:
ABE-0008894
CGSC:
11886
ECHOBASE:
EB0963
ECOLIHUB:
srlB
OU-MICROARRAY:
b2704
STRING:
511145.b2704
COLOMBOS: srlB


Product      
Name: sorbitol-specific PTS enzyme IIA component
Synonym(s): Enzyme IIIsorbitol, GutB, SrlB, enzyme IIA component of sorbitol PTS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 13.304
Isoelectric point: 4.685
Motif(s):
 
Type Positions Sequence Comment
3 -> 116 VIYQTTITRIGASAIDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSVL UniProt: PTS EIIA type-5.
4 -> 115 IYQTTITRIGASAIDALSDQMLITFREGAPADLEEYCFIHCHGELKGALHPGLQFSLGQHRYPVTAVGSVAEDNLRELGHVTLRFDGLNEAEFPGTVHVAGPVPDDIAPGSV
17 -> 17 I UniProt: In strain: ECOR 6, ECOR 28, ECOR 35, ECOR 37, ECOR 51, ECOR 58, ECOR 61, ECOR 66 and ECOR 69..
51 -> 51 A UniProt: In strain: ECOR 58..
59 -> 59 S UniProt: In strain: ECOR 28, ECOR 37, ECOR 58 and ECOR 69..

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.4 - Group Translocators --> 4.4.A - Phosphotransferase Systems (PEP-dependent PTS)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:1902495 - transmembrane transporter complex
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity
biological_process GO:0008643 - carbohydrate transport
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
GO:0016310 - phosphorylation
GO:0034219 - carbohydrate transmembrane transport
GO:0015795 - sorbitol transport
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P05706
ECOCYC:
GUTB-MONOMER
ECOLIWIKI:
b2704
INTERPRO:
IPR018454
INTERPRO:
IPR036665
INTERPRO:
IPR004716
PANTHER:
PTHR40398
PFAM:
PF03829
PRIDE:
P05706
PRODB:
PRO_000023984
PROSITE:
PS51097
REFSEQ:
NP_417184
SMR:
P05706
SWISSMODEL:
P05706
UNIPROT:
P05706


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB