RegulonDB RegulonDB 10.9: Gene Form
   

srlD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

srlD srlB gutM TSS_3017 (cluster) TSS_3017 (cluster) srlRp srlRp

Gene      
Name: srlD    Texpresso search in the literature
Synonym(s): ECK2700, EG10971, b2705, gutD
Genome position(nucleotides): 2827737 --> 2828516 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.33
Reference(s): [1] Yamada M., et al., 1987
External database links:  
ASAP:
ABE-0008896
CGSC:
153
ECHOBASE:
EB0964
ECOLIHUB:
srlD
OU-MICROARRAY:
b2705
STRING:
511145.b2705
COLOMBOS: srlD


Product      
Name: sorbitol-6-phosphate 2-dehydrogenase
Synonym(s): GutD, SrlD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.858
Isoelectric point: 6.262
Motif(s):
 
Type Positions Sequence
4 -> 33 VAVVIGGGQTLGAFLCHGLAAEGYRVAVVD
3 -> 197 QVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVHSLMLGNLLKSPMFQSLL
68 -> 68 V

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0009010 - sorbitol-6-phosphate 2-dehydrogenase activity
GO:0042802 - identical protein binding
biological_process GO:0055114 - oxidation-reduction process
GO:0051289 - protein homotetramerization
GO:0006062 - sorbitol catabolic process
External database links:  
DIP:
DIP-10917N
ECOCYC:
SORB6PDEHYDROG-MONOMER
ECOLIWIKI:
b2705
INTERPRO:
IPR036291
INTERPRO:
IPR020904
INTERPRO:
IPR002347
MODBASE:
P05707
PFAM:
PF00106
PRIDE:
P05707
PRINTS:
PR00080
PRINTS:
PR00081
PRODB:
PRO_000023985
PROSITE:
PS00061
REFSEQ:
NP_417185
SMR:
P05707
UNIPROT:
P05707


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3017 (cluster) 2828961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Yamada M., Saier MH., 1987, Physical and genetic characterization of the glucitol operon in Escherichia coli., J Bacteriol 169(7):2990-4

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB