RegulonDB RegulonDB 10.9: Gene Form
   

gutM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: gutM    Texpresso search in the literature
Synonym(s): ECK2701, EG10972, b2706, gut, srlM
Genome position(nucleotides): 2828621 --> 2828980 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.0
External database links:  
ASAP:
ABE-0008898
CGSC:
33198
ECHOBASE:
EB0965
ECOLIHUB:
gutM
OU-MICROARRAY:
b2706
STRING:
511145.b2706
COLOMBOS: gutM


Product      
Name: DNA-binding transcriptional activator GutM
Synonym(s): Gut, GutM, SrlM
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GutM
Molecular weight: 12.953
Isoelectric point: 11.199
Motif(s):
 
Type Positions Sequence
5 -> 110 LITVAVIAWCAQLALGGWQISRFNRAFDTLCQQGRVGVGRSSGRFKPRVVVAIALDDQQRIVDTLFMKGLTVFARPQKIPAITGMHAGDLQPDVIFPHDPLSQNAL
23 -> 29 QISRFNR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
Reference(s): [1] Yamada M., et al., 1988
External database links:  
ECOCYC:
PD00345
ECOLIWIKI:
b2706
ECOO157CYC:
GUTM-MONOMER
INTERPRO:
IPR009693
PFAM:
PF06923
PRIDE:
P15081
REFSEQ:
NP_417186
UNIPROT:
P15081


Operon      
Name: srlAEBD-gutM-srlR-gutQ         
Operon arrangement:
Transcription unit        Promoter
srlAEBD-gutM-srlR-gutQ
srlR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, GutM
Repressed by: SrlR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3017 (cluster) 2828961 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3018 (cluster) 2829709 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3019 2829746 forward nd [RS-EPT-CBR] [2]



RegulonDB