RegulonDB RegulonDB 10.9: Gene Form
   

tdh gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kbl waaH tdh yibQ NsrR PhoB PhoB anti-anti-terminator anti-terminator terminator yibDp1 yibDp1

Gene      
Name: tdh    Texpresso search in the literature
Synonym(s): ECK3606, EG10993, b3616
Genome position(nucleotides): 3790320 <-- 3791345 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
Reference(s): [1] Landgraf JR., et al., 1994
[2] Ravnikar PD., et al., 1986
External database links:  
ASAP:
ABE-0011830
CGSC:
17584
ECHOBASE:
EB0986
ECOLIHUB:
tdh
OU-MICROARRAY:
b3616
STRING:
511145.b3616
COLOMBOS: tdh


Product      
Name: threonine dehydrogenase
Synonym(s): Tdh
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.239
Isoelectric point: 6.351
Motif(s):
 
Type Positions Sequence
174 -> 303 PIGIMAAAVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAALIQ
26 -> 134 NDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFK
286 -> 287 IY
38 -> 38 C
262 -> 264 LGI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.30 - threonine catabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008270 - zinc ion binding
GO:0008198 - ferrous iron binding
GO:0008743 - L-threonine 3-dehydrogenase activity
GO:0046870 - cadmium ion binding
GO:0030145 - manganese ion binding
GO:0042802 - identical protein binding
biological_process GO:0006564 - L-serine biosynthetic process
GO:0006567 - threonine catabolic process
GO:0019518 - L-threonine catabolic process to glycine
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-6855N
ECOCYC:
THREODEHYD-MONOMER
ECOLIWIKI:
b3616
INTERPRO:
IPR013149
INTERPRO:
IPR013154
INTERPRO:
IPR020843
INTERPRO:
IPR011032
INTERPRO:
IPR036291
INTERPRO:
IPR002328
INTERPRO:
IPR004627
MODBASE:
P07913
PFAM:
PF08240
PFAM:
PF00107
PRIDE:
P07913
PRODB:
PRO_000024044
PROSITE:
PS00059
REFSEQ:
NP_418073
SMART:
SM00829
SMR:
P07913
UNIPROT:
P07913


Operon      
Name: kbl-tdh         
Operon arrangement:
Transcription unit        Promoter
kbl-tdh


Transcriptional Regulation      
Display Regulation             
Activated by: Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Landgraf JR., Levinthal M., Danchin A., 1994, The role of H-NS in one carbon metabolism., Biochimie 76(10-11):1063-70

 [2] Ravnikar PD., Somerville RL., 1986, Localization of the structural gene for threonine dehydrogenase in Escherichia coli., J Bacteriol 168(1):434-6


RegulonDB