RegulonDB RegulonDB 10.8: Gene Form
   

thyA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lgt thyA ppdA ppdB anti-anti-terminator anti-terminator terminator thyAp2 thyAp2 thyAp thyAp TSS_3128 (cluster) TSS_3128 (cluster) ppdAp ppdAp

Gene      
Name: thyA    Texpresso search in the literature
Synonym(s): ECK2823, EG11002, b2827
Genome position(nucleotides): 2964361 <-- 2965155 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.07
External database links:  
ASAP:
ABE-0009268
CGSC:
104
ECHOBASE:
EB0995
NCBI-GENE:
949035
OU-MICROARRAY:
b2827
PortEco:
thyA
STRING:
511145.b2827
COLOMBOS: thyA


Product      
Name: thymidylate synthase
Synonym(s): ThyA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.48
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
207 -> 209 HLY
50 -> 50 C
177 -> 177 N
166 -> 169 RSCD
2 -> 264 KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0004799 - thymidylate synthase activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006417 - regulation of translation
GO:0009165 - nucleotide biosynthetic process
GO:0009314 - response to radiation
GO:0032259 - methylation
GO:0006231 - dTMP biosynthetic process
GO:0006235 - dTTP biosynthetic process
External database links:  
DIP:
DIP-48261N
ECOCYC:
THYMIDYLATESYN-MONOMER
ECOLIWIKI:
b2827
INTERPRO:
IPR000398
INTERPRO:
IPR036926
INTERPRO:
IPR023451
INTERPRO:
IPR020940
MINT:
MINT-1265510
MODBASE:
P0A884
PDB:
6NNR
PDB:
1AIQ
PDB:
1AJM
PDB:
1AN5
PDB:
1AOB
PDB:
1AXW
PDB:
1BDU
PDB:
1BID
PDB:
1BJG
PDB:
1BQ1
PDB:
1BQ2
PDB:
1DDU
PDB:
1DNA
PDB:
1EV5
PDB:
1EV8
PDB:
1EVF
PDB:
1EVG
PDB:
1F4B
PDB:
1F4C
PDB:
1F4D
PDB:
1F4E
PDB:
1F4F
PDB:
1F4G
PDB:
1FFL
PDB:
1FWM
PDB:
1JG0
PDB:
1JTQ
PDB:
1JTU
PDB:
1JUT
PDB:
1KCE
PDB:
1KZI
PDB:
1KZJ
PDB:
1NCE
PDB:
1QQQ
PDB:
1SYN
PDB:
1TDU
PDB:
1TJS
PDB:
1TLC
PDB:
1TLS
PDB:
1TRG
PDB:
1TSD
PDB:
1TSN
PDB:
1TYS
PDB:
1ZPR
PDB:
2A9W
PDB:
2BBQ
PDB:
2FTN
PDB:
2FTO
PDB:
2FTQ
PDB:
2G8X
PDB:
2KCE
PDB:
2TSC
PDB:
2VET
PDB:
2VF0
PDB:
3B5B
PDB:
3B9H
PDB:
3BFI
PDB:
3BGX
PDB:
3BHL
PDB:
3BHR
PDB:
3TMS
PDB:
4F2V
PDB:
4GEV
PDB:
4ISK
PDB:
6CDZ
PFAM:
PF00303
PRIDE:
P0A884
PRINTS:
PR00108
PROSITE:
PS00091
REFSEQ:
NP_417304
SMR:
P0A884
UNIPROT:
P0A884


Operon      
Name: lgt-thyA         
Operon arrangement:
Transcription unit        Promoter
thyA
lgt
lgt-thyA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3128 (cluster) 2965245 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter thyAp2 2965348 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB