RegulonDB RegulonDB 10.9: Gene Form
   

ptrB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ptrB exoX yebE yobB ptrBp ptrBp TSS_2187 (cluster) TSS_2187 (cluster)

Gene      
Name: ptrB    Texpresso search in the literature
Synonym(s): ECK1846, EG11004, b1845, tlp
Genome position(nucleotides): 1926779 <-- 1928839 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.83
External database links:  
ASAP:
ABE-0006133
CGSC:
32339
ECHOBASE:
EB0997
ECOLIHUB:
ptrB
OU-MICROARRAY:
b1845
STRING:
511145.b1845
COLOMBOS: ptrB


Product      
Name: oligopeptidase B
Synonym(s): OpdB, PtrB, Tlp, protease II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 79.49
Isoelectric point: 5.931
Motif(s):
 
Type Positions Sequence
3 -> 403 PKAARIPHAMTLHGDTRIDNYYWLRDDTRSQPEVLDYLQQENSYGHRVMASQQALQDRILKEIIDRIPQREVSAPYIKNGYRYRHIYEPGCEYAIYQRQSAFSEEWDEWETLLDANKRAAHSEFYSMGGMAITPDNTIMALAEDFLSRRQYGIRFRNLETGNWYPELLDNVEPSFVWANDSWIFYYVRKHPVTLLPYQVWRHAIGTPASQDKLIYEEKDDTYYVSLHKTTSKHYVVIHLASATTSEVRLLDAEMADAEPFVFLPRRKDHEYSLDHYQHRFYLRSNRHGKNFGLYRTRMRDEQQWEELIPPRENIMLEGFTLFTDWLVVEERQRGLTSLRQINRKTREVIGIAFDDPAYVTWIAYNPEPETARLRYGYSSMTTPDTLFELDMDTGERRVLKQ
682 -> 686 ATPAD
463 -> 676 FSFSRLSLLDRGFVYAIVHVRGGGELGQQWYEDGKFLKKKNTFNDYLDACDALLKLGYGSPSLCYAMGGSAGGMLMGVAINQRPELFHGVIAQVPFVDVVTTMLDESIPLTTGEFEEWGNPQDPQYYEYMKSYSPYDNVTAQAYPHLLVTTGLHDSQVQYWEPAKWVAKLRELKTDDHLLLLCTDMDSGHGGKSGRFKSYEGVAMEYAFLVALA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.3 - proteins/peptides/glycopeptides
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0070012 - oligopeptidase activity
GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0004252 - serine-type endopeptidase activity
GO:0008236 - serine-type peptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
Reference(s): [1] Kanatani A., et al., 1992
[2] Polgar L., et al., 1998
[3] Tsuji A., et al., 2006
[4] Tsuru D., et al., 1994
External database links:  
ECOCYC:
EG11004-MONOMER
ECOLIWIKI:
b1845
ECOO157CYC:
PTRB-MONOMER
INTERPRO:
IPR001375
INTERPRO:
IPR029058
INTERPRO:
IPR023302
INTERPRO:
IPR002471
INTERPRO:
IPR002470
MODBASE:
P24555
PFAM:
PF02897
PFAM:
PF00326
PRIDE:
P24555
PRINTS:
PR00862
PRODB:
PRO_000023630
PROSITE:
PS00708
REFSEQ:
NP_416359
SMR:
P24555
UNIPROT:
P24555


Operon      
Name: ptrB         
Operon arrangement:
Transcription unit        Promoter
ptrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2187 (cluster) 1926096 forward For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kanatani A., Yoshimoto T., Nagai H., Ito K., Tsuru D., 1992, Location of the protease II gene (ptrB) on the physical map of the Escherichia coli chromosome., J Bacteriol 174(23):7881

 [2] Polgar L., Felfoldi F., 1998, Oligopeptidase B: cloning and probing stability under nonequilibrium conditions., Proteins 30(4):424-34

 [3] Tsuji A., Yoshimoto T., Yuasa K., Matsuda Y., 2006, Protamine: a unique and potent inhibitor of oligopeptidase B., J Pept Sci 12(1):65-71

 [4] Tsuru D., Yoshimoto T., 1994, Oligopeptidase B: protease II from Escherichia coli., Methods Enzymol 244:201-15

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB