RegulonDB RegulonDB 10.9: Gene Form
   

tolB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolB tolA pal terminator anti-terminator anti-anti-terminator TSS_896 TSS_896 TSS_895 TSS_895 TSS_894 TSS_894 TSS_893 TSS_893 TSS_892 TSS_892 TSS_891 TSS_891 tolBp3 tolBp3 tolBp6 tolBp6 TSS_890 (cluster) TSS_890 (cluster)

Gene      
Name: tolB    Texpresso search in the literature
Synonym(s): ECK0729, EG11008, b0740, lky, lkyA, tol-3
Genome position(nucleotides): 777740 --> 779032 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.13
Reference(s): [1] Levengood SK., et al., 1989
External database links:  
ASAP:
ABE-0002517
CGSC:
98
ECHOBASE:
EB1001
ECOLIHUB:
tolB
OU-MICROARRAY:
b0740
STRING:
511145.b0740
COLOMBOS: tolB


Product      
Name: Tol-Pal system periplasmic protein TolB
Synonym(s): Lky, LkyA, TolB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 45.956
Isoelectric point: 7.834
Motif(s):
 
Type Positions Sequence
166 -> 200 RIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRSPQ
246 -> 286 NGAPAFSPDGSKLAFALSKTGSLNLYVMDLASGQIRQVTDG
141 -> 155 LRYAGHTASDEVFEK
290 -> 330 NTEPTWFPDSQNLAFTSDQAGRPQVYKVNINGGAPQRITWE
377 -> 418 DETPSLAPNGTMVIYSSSQGMGSVLNLVSTDGRFKARLPATD

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
  8 - extrachromosomal --> 8.4 - colicin related
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0032991 - protein-containing complex
GO:0032153 - cell division site
molecular_function GO:0019904 - protein domain specific binding
GO:0005515 - protein binding
GO:0044877 - protein-containing complex binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0015031 - protein transport
GO:0017038 - protein import
GO:0043213 - bacteriocin transport
GO:0090529 - cell septum assembly
GO:0071237 - cellular response to bacteriocin
Note(s): Note(s): ...[more].
Reference(s): [2] Benedetti H., et al., 1991
[3] Bouveret E., et al., 1998
[4] Duche D., et al., 2006
[5] Hersch SJ., et al., 2020
[6] Housden NG., et al., 2013
[7] Loftus SR., et al., 2006
[8] McBroom AJ., et al., 2006
External database links:  
DIP:
DIP-48262N
ECOCYC:
EG11008-MONOMER
ECOLIWIKI:
b0740
INTERPRO:
IPR014167
INTERPRO:
IPR036752
INTERPRO:
IPR007195
INTERPRO:
IPR011042
INTERPRO:
IPR011659
MINT:
P0A855
MODBASE:
P0A855
PDB:
2HQS
PDB:
1CRZ
PDB:
1C5K
PDB:
2W8B
PDB:
2IVZ
PDB:
3IAX
PFAM:
PF07676
PFAM:
PF04052
PRIDE:
P0A855
PRODB:
PRO_000024079
REFSEQ:
NP_415268
SMR:
P0A855
UNIPROT:
P0A855


Operon      
Name: tolB-pal-cpoB         
Operon arrangement:
Transcription unit        Promoter
tolB-pal-ybgF


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_890 (cluster) 777229 forward For this promoter, there
Read more >
[RS-EPT-CBR] [9]
  promoter tolBp6 777537 forward Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter tolBp3 777560 forward Similarity to the consensus
Read more >
[ICWHO] [10]
  promoter TSS_891 777769 forward nd [RS-EPT-CBR] [9]
  promoter TSS_892 778129 forward nd [RS-EPT-CBR] [9]
  promoter TSS_893 778824 forward nd [RS-EPT-CBR] [9]
  promoter TSS_894 778979 forward nd [RS-EPT-CBR] [9]
  promoter TSS_895 779058 forward nd [RS-EPT-CBR] [9]
  promoter TSS_896 779365 forward nd [RS-EPT-CBR] [9]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Levengood SK., Webster RE., 1989, Nucleotide sequences of the tolA and tolB genes and localization of their products, components of a multistep translocation system in Escherichia coli., J Bacteriol 171(12):6600-9

 [2] Benedetti H., Frenette M., Baty D., Knibiehler M., Pattus F., Lazdunski C., 1991, Individual domains of colicins confer specificity in colicin uptake, in pore-properties and in immunity requirement., J Mol Biol 217(3):429-39

 [3] Bouveret E., Rigal A., Lazdunski C., Benedetti H., 1998, Distinct regions of the colicin A translocation domain are involved in the interaction with TolA and TolB proteins upon import into Escherichia coli., Mol Microbiol 27(1):143-57

 [4] Duche D., Frenkian A., Prima V., Lloubes R., 2006, Release of immunity protein requires functional endonuclease colicin import machinery., J Bacteriol 188(24):8593-600

 [5] Hersch SJ., Watanabe N., Stietz MS., Manera K., Kamal F., Burkinshaw B., Lam L., Pun A., Li M., Savchenko A., Dong TG., 2020, Envelope stress responses defend against type six secretion system attacks independently of immunity proteins., Nat Microbiol 5(5):706-714

 [6] Housden NG., Hopper JT., Lukoyanova N., Rodriguez-Larrea D., Wojdyla JA., Klein A., Kaminska R., Bayley H., Saibil HR., Robinson CV., Kleanthous C., 2013, Intrinsically disordered protein threads through the bacterial outer-membrane porin OmpF., Science 340(6140):1570-4

 [7] Loftus SR., Walker D., Mate MJ., Bonsor DA., James R., Moore GR., Kleanthous C., 2006, Competitive recruitment of the periplasmic translocation portal TolB by a natively disordered domain of colicin E9., Proc Natl Acad Sci U S A 103(33):12353-8

 [8] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [9] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [10] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB