RegulonDB RegulonDB 10.9: Gene Form
   

trxA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rhlB trxA rhoL CRP ppGpp ppGpp TSS_4425 (cluster) TSS_4425 (cluster) rhoLp rhoLp TSS_4423 TSS_4423 TSS_4422 TSS_4422 TSS_4421 TSS_4421 TSS_4420 TSS_4420 TSS_4419 (cluster) TSS_4419 (cluster) TSS_4418 TSS_4418 trxAp2 trxAp2 TSS_4417 TSS_4417 trxAp3 trxAp3 trxAp1 trxAp1 TSS_4415 TSS_4415 TSS_4414 (cluster) TSS_4414 (cluster) TSS_4413 TSS_4413 TSS_4412 TSS_4412 TSS_4411 TSS_4411 TSS_4410 TSS_4410

Gene      
Name: trxA    Texpresso search in the literature
Synonym(s): ECK3773, EG11031, b3781, dasC, fipA, tsnC
Genome position(nucleotides): 3965761 --> 3966090 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.91
Reference(s): [1] Lim CJ., et al., 1985
External database links:  
ASAP:
ABE-0012357
CGSC:
65
ECHOBASE:
EB1024
ECOLIHUB:
trxA
MIM:
616811
OU-MICROARRAY:
b3781
STRING:
511145.b3781
COLOMBOS: trxA


Product      
Name: thioredoxin 1
Synonym(s): DasC, FipA, TRX1, TrxA, TsnC, thioredoxin(SH)2
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 11.807
Isoelectric point: 4.457
Motif(s):
 
Type Positions Sequence
2 -> 109 SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
88 -> 88 A
72 -> 73 GI
5 -> 105 IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.2 - thioredoxin, glutaredoxin
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
GO:0016671 - oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor
GO:0015035 - protein disulfide oxidoreductase activity
GO:0047134 - protein-disulfide reductase activity
GO:0030337 - DNA polymerase processivity factor activity
biological_process GO:1900264 - positive regulation of DNA-directed DNA polymerase activity
GO:0006259 - DNA metabolic process
GO:0016032 - viral process
GO:0006662 - glycerol ether metabolic process
GO:0045454 - cell redox homeostasis
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [APPHINH] Assay of protein purified to homogeneity from its native host
Reference(s): [2] Gleason FK., et al., 1990
External database links:  
DIP:
DIP-31856N
ECOCYC:
RED-THIOREDOXIN-MONOMER
ECOLIWIKI:
b3781
INTERPRO:
IPR005746
INTERPRO:
IPR013766
INTERPRO:
IPR036249
INTERPRO:
IPR017937
LIGAND-CPD:
C00342
MINT:
P0AA25
MODBASE:
P0AA25
PDB:
1F6M
PDB:
1KEB
PDB:
1M7T
PDB:
1OAZ
PDB:
1SKR
PDB:
1SKS
PDB:
1SKW
PDB:
1SL0
PDB:
1SL1
PDB:
1SL2
PDB:
1SRX
PDB:
1T7P
PDB:
1T8E
PDB:
1THO
PDB:
1TK0
PDB:
1TK5
PDB:
1TK8
PDB:
1TKD
PDB:
1TXX
PDB:
1X9M
PDB:
1X9S
PDB:
1X9W
PDB:
1XOA
PDB:
1XOB
PDB:
1ZCP
PDB:
1ZYQ
PDB:
1ZZY
PDB:
2AJQ
PDB:
2BTO
PDB:
2EIO
PDB:
2EIQ
PDB:
2EIR
PDB:
2FCH
PDB:
2FD3
PDB:
2H6X
PDB:
2H6Y
PDB:
2H6Z
PDB:
2H70
PDB:
2H71
PDB:
2H72
PDB:
2H73
PDB:
2H74
PDB:
2H75
PDB:
2H76
PDB:
2O8V
PDB:
2TIR
PDB:
2TRX
PDB:
3DYR
PDB:
4HU7
PDB:
4HU9
PDB:
4HUA
PDB:
4X43
PDB:
5HR0
PDB:
5HR1
PDB:
5HR2
PDB:
5HR3
PDB:
5XOC
PDB:
6GD1
PDB:
6GDG
PDB:
6H7J
PDB:
6H7L
PDB:
6H7M
PDB:
6H7N
PDB:
6H7O
PDB:
6IBL
PDB:
6LUR
PDB:
6N7W
PFAM:
PF00085
PRIDE:
P0AA25
PRODB:
PRO_000024129
PROSITE:
PS00194
PROSITE:
PS51352
REFSEQ:
NP_418228
SMR:
P0AA25
UNIPROT:
P0AA25


Operon      
Name: trxA         
Operon arrangement:
Transcription unit        Promoter
trxA
trxA
trxA


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4410 3964499 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4411 3964980 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4412 3965171 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4413 3965222 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4414 (cluster) 3965617 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4415 3965630 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4417 3965652 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4418 3965691 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4419 (cluster) 3965693 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4420 3965697 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4421 3965740 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4422 3965743 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4423 3965796 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4425 (cluster) 3966246 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lim CJ., Geraghty D., Fuchs JA., 1985, Cloning and nucleotide sequence of the trxA gene of Escherichia coli K-12., J Bacteriol 163(1):311-6

 [2] Gleason FK., Lim CJ., Gerami-Nejad M., Fuchs JA., 1990, Characterization of Escherichia coli thioredoxins with altered active site residues., Biochemistry 29(15):3701-9

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB