RegulonDB RegulonDB 10.8: Gene Form
   

tsf gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tsf rpsB pyrH terminator terminator anti-terminator anti-anti-terminator TSS_329 (cluster) TSS_329 (cluster) pyrHp pyrHp TSS_327 TSS_327 TSS_326 TSS_326 TSS_325 TSS_325 TSS_324 TSS_324 TSS_323 TSS_323 TSS_322 TSS_322 TSS_321 TSS_321 TSS_320 TSS_320 TSS_319 (cluster) TSS_319 (cluster) TSS_318 TSS_318 TSS_317 TSS_317

Gene      
Name: tsf    Texpresso search in the literature
Synonym(s): ECK0169, EG11033, b0170
Genome position(nucleotides): 190857 --> 191708 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.88
External database links:  
ASAP:
ABE-0000579
CGSC:
64
ECHOBASE:
EB1026
MIM:
610505
OU-MICROARRAY:
b0170
PortEco:
tsf
STRING:
511145.b0170
COLOMBOS: tsf


Product      
Name: protein chain elongation factor EF-Ts
Synonym(s): EF1B, Tsf
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.423
Isoelectric point: 4.952
Motif(s):
 
Type Positions Sequence
219 -> 219 R
24 -> 24 K
186 -> 225 VSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTG
82 -> 82 F
2 -> 283 AEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSGAIKAAKKAGNVAADGVIKTKIDGNYGIILEVNCQTDFVAKDAGFQAFADKVLDAAVAGKITDVEVLKAQFEEERVALVAKIGENINIRRVAALEGDVLGSYQHGARIGVLVAAKGADEELVKHIAMHVAASKPEFIKPEDVSAEVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKKFTGEVSLTGQPFVMEPSKTVGQLLKEHNAEVTGFIRFEVGEGIEKVETDFAAEVAAMSKQS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003746 - translation elongation factor activity
GO:0005515 - protein binding
GO:0008270 - zinc ion binding
GO:0005085 - guanyl-nucleotide exchange factor activity
biological_process GO:0006412 - translation
GO:0006414 - translational elongation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Han KY., et al., 2007
[2] Miyajima A., et al., 1978
[3] Pan JY., et al., 2011
[4] Wieden HJ., et al., 2010
[5] Wurmbach P., et al., 1979
External database links:  
DIP:
DIP-31835N
ECOCYC:
EG11033-MONOMER
ECOLIWIKI:
b0170
INTERPRO:
IPR001816
INTERPRO:
IPR036402
INTERPRO:
IPR009060
INTERPRO:
IPR018101
INTERPRO:
IPR014039
MINT:
MINT-1273899
PANTHER:
PTHR11741
PDB:
3VNU
PDB:
3VNV
PDB:
4PC3
PDB:
4PC7
PDB:
4Q7J
PDB:
4R71
PDB:
3MMP
PDB:
3AVY
PDB:
3AVX
PDB:
3AVW
PDB:
3AVV
PDB:
3AVU
PDB:
3AVT
PDB:
3AGQ
PDB:
3AGP
PDB:
1EFU
PDB:
4FWT
PFAM:
PF00889
PRIDE:
P0A6P1
PRODB:
PRO_000024132
PROSITE:
PS01127
PROSITE:
PS01126
REFSEQ:
NP_414712
SMR:
P0A6P1
UNIPROT:
P0A6P1


Operon      
Name: tff-rpsB-tsf         
Operon arrangement:
Transcription unit        Promoter
rpsB-tsf


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_317 190209 forward nd [RS-EPT-CBR] [6]
  promoter TSS_318 190213 forward nd [RS-EPT-CBR] [6]
  promoter TSS_319 (cluster) 190227 forward For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter TSS_320 190234 forward nd [RS-EPT-CBR] [6]
  promoter TSS_321 190257 forward nd [RS-EPT-CBR] [6]
  promoter TSS_322 190355 forward nd [RS-EPT-CBR] [6]
  promoter TSS_323 190448 forward nd [RS-EPT-CBR] [6]
  promoter TSS_324 190803 forward nd [RS-EPT-CBR] [6]
  promoter TSS_325 190841 forward nd [RS-EPT-CBR] [6]
  promoter TSS_326 191752 forward nd [RS-EPT-CBR] [6]
  promoter TSS_327 191754 forward nd [RS-EPT-CBR] [6]
  promoter TSS_329 (cluster) 191819 forward For this promoter, there
Read more >
[RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Han KY., Song JA., Ahn KY., Park JS., Seo HS., Lee J., 2007, Enhanced solubility of heterologous proteins by fusion expression using stress-induced Escherichia coli protein, Tsf., FEMS Microbiol Lett 274(1):132-8

 [2] Miyajima A., Kaziro Y., 1978, Coordination of levels of elongation factors Tu, Ts, and G, and ribosomal protein SI in Escherichia coli., J Biochem 83(2):453-62

 [3] Pan JY., Wu H., Liu X., Li PP., Li H., Wang SY., Peng XX., 2011, Complexome of Escherichia coli cytosolic proteins under normal native conditions., Mol Biosyst 7(9):2651-63

 [4] Wieden HJ., Mercier E., Gray J., Steed B., Yawney D., 2010, A combined molecular dynamics and rapid kinetics approach to identify conserved three-dimensional communication networks in elongation factor Tu., Biophys J 99(11):3735-43

 [5] Wurmbach P., Nierhaus KH., 1979, Isolation of the protein synthesis elongation factors EF-Tu, EF-Ts, and EF-G from Escherichia coli., Methods Enzymol 60:593-606

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB