RegulonDB RegulonDB 10.9: Gene Form
   

tsr gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btsT tsr lgoT CRP BtsR CpxR terminator terminator tsrp tsrp tsrp1 tsrp1 yjiYp yjiYp yjiYp3 yjiYp3

Gene      
Name: tsr    Texpresso search in the literature
Synonym(s): ECK4345, EG11034, b4355, cheD
Genome position(nucleotides): 4591657 --> 4593312 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.65
Reference(s): [1] Boyd A., et al., null
External database links:  
ASAP:
ABE-0014282
CGSC:
63
ECHOBASE:
EB1027
ECOLIHUB:
tsr
OU-MICROARRAY:
b4355
STRING:
511145.b4355
COLOMBOS: tsr


Product      
Name: methyl-accepting chemotaxis protein Tsr
Synonym(s): CheD, MCP-I, Tsr, Tsr dimer, chemotaxis signaling protein I, serine chemoreceptor protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 59.443
Isoelectric point: 4.609
Motif(s):
 
Type Positions Sequence
383 -> 397 AVEAARAGEQGRGFA
64 -> 73 RNTLNRAGIR
216 -> 268 ASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVG
273 -> 502 GANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALE
437 -> 514 SAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAV

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0098561 - methyl accepting chemotaxis protein complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0004888 - transmembrane signaling receptor activity
GO:0042802 - identical protein binding
biological_process GO:0043113 - receptor clustering
GO:0007172 - signal complex assembly
GO:0032110 - regulation of protein histidine kinase activity
GO:0007165 - signal transduction
GO:0009593 - detection of chemical stimulus
GO:0006935 - chemotaxis
GO:0050920 - regulation of chemotaxis
GO:0048870 - cell motility
GO:1902021 - regulation of bacterial-type flagellum-dependent cell motility
GO:0071230 - cellular response to amino acid stimulus
External database links:  
DIP:
DIP-11046N
ECOCYC:
TSR-MONOMER
ECOLIWIKI:
b4355
INTERPRO:
IPR003660
INTERPRO:
IPR004090
INTERPRO:
IPR003122
INTERPRO:
IPR004091
INTERPRO:
IPR035440
INTERPRO:
IPR004089
MINT:
P02942
MODBASE:
P02942
PDB:
6S1K
PDB:
3ZX6
PDB:
3ATP
PDB:
2D4U
PDB:
1QU7
PFAM:
PF02203
PFAM:
PF00672
PFAM:
PF00015
PRIDE:
P02942
PRINTS:
PR00260
PRODB:
PRO_000024134
PROSITE:
PS50885
PROSITE:
PS50111
PROSITE:
PS00538
REFSEQ:
NP_418775
SMART:
SM00283
SMART:
SM00304
SMART:
SM00319
SMR:
P02942
UNIPROT:
P02942


Operon      
Name: tsr         
Operon arrangement:
Transcription unit        Promoter
tsr
tsr


Transcriptional Regulation      
Display Regulation             
Repressed by: CpxR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiYp3 4591347 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Boyd A., Kendall K., Simon MI., null, Structure of the serine chemoreceptor in Escherichia coli., Nature 301(5901):623-6

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB