RegulonDB RegulonDB 10.9: Gene Form
   

ubiX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purF argT ubiX NtrC NtrC GcvB ppGpp terminator TSS_2620 TSS_2620 argTp argTp

Gene      
Name: ubiX    Texpresso search in the literature
Synonym(s): ECK2305, EG11044, b2311, dedF
Genome position(nucleotides): 2428057 <-- 2428626 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.16
External database links:  
ASAP:
ABE-0007628
CGSC:
17797
ECHOBASE:
EB1037
ECOLIHUB:
ubiX
OU-MICROARRAY:
b2311
STRING:
511145.b2311
COLOMBOS: ubiX


Product      
Name: flavin prenyltransferase
Synonym(s): DedF, UbiX
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.695
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
88 -> 91 SIKT
62 -> 62 T
139 -> 148 AEIGAVIMPP
2 -> 165 KRLIVGISGASGAIYGVRLLQVLRDVTDIETHLVMSQAARQTLSLETDFSLREVQALADVTHDARDIAASISSGSFQTLGMVILPCSIKTLSGIVHSYTDGLLTRAADVVLKERRPLVLCVRETPLHLGHLRLMTQAAEIGAVIMPPVPAFYHRPQSLDDVINQ
10 -> 12 GAS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0106141 - flavin prenyltransferase activity
GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016831 - carboxy-lyase activity
GO:0004659 - prenyltransferase activity
biological_process GO:0120232 - prenyl-FMNH2 biosynthetic process
GO:0006744 - ubiquinone biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Nonet ML., et al., 1987
External database links:  
DIP:
DIP-47873N
ECOCYC:
UBIX-MONOMER
ECOLIWIKI:
b2311
INTERPRO:
IPR036551
INTERPRO:
IPR004507
INTERPRO:
IPR003382
MODBASE:
P0AG03
PANTHER:
PTHR43374
PFAM:
PF02441
PRIDE:
P0AG03
REFSEQ:
NP_416814
SMR:
P0AG03
SWISSMODEL:
P0AG03
UNIPROT:
P0AG03


Operon      
Name: cvpA-purF-ubiX         
Operon arrangement:
Transcription unit        Promoter
cvpA-purF-ubiX
cvpA-purF-ubiX
ubiX


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2620 2427937 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Nonet ML., Marvel CC., Tolan DR., 1987, The hisT-purF region of the Escherichia coli K-12 chromosome. Identification of additional genes of the hisT and purF operons., J Biol Chem 262(25):12209-17

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB