RegulonDB RegulonDB 10.8: Gene Form
   

ugpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ugpB ugpC ugpA ugpE ugpQ terminator ugpQp1 ugpQp1

Gene      
Name: ugpA    Texpresso search in the literature
Synonym(s): ECK3436, EG11046, b3452, psiB, psiC, ugp
Genome position(nucleotides): 3590024 <-- 3590911 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.86
External database links:  
ASAP:
ABE-0011272
CGSC:
40
ECHOBASE:
EB1039
OU-MICROARRAY:
b3452
PortEco:
ugpA
STRING:
511145.b3452
COLOMBOS: ugpA


Product      
Name: sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA
Synonym(s): PsiB, PsiC, Ugp, UgpA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.264
Isoelectric point: 9.033
Motif(s):
 
Type Positions Sequence
157 -> 177 AMFLVVFASVWKQISYNFLFF
76 -> 284 IKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPAVAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAALQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSGGPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQ
81 -> 101 FVTVSGLLVSLFFAALVEYIV
110 -> 130 LMLLPYAVAPAVAAVLWIFLF
263 -> 283 LASSAAQSVVLMFLVIVLTVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0015169 - glycerol-3-phosphate transmembrane transporter activity
GO:0001406 - glycerophosphodiester transmembrane transporter activity
biological_process GO:0015794 - glycerol-3-phosphate transmembrane transport
GO:0055085 - transmembrane transport
GO:0001407 - glycerophosphodiester transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11077N
ECOCYC:
UGPA-MONOMER
ECOLIWIKI:
b3452
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P10905
PRODB:
PRO_000024164
PROSITE:
PS50928
REFSEQ:
NP_417909
SMR:
P10905
UNIPROT:
P10905


Operon      
Name: ugpBAECQ         
Operon arrangement:
Transcription unit        Promoter
ugpBAECQ
ugpBAECQ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoB
Repressed by: PhoB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ugpQp1 3588300 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB