RegulonDB RegulonDB 10.8: Gene Form
   

ugpB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ugpB ugpA livF ugpE PhoB CRP PhoB PhoB terminator terminator ugpBp2 ugpBp2 ugpBp1 ugpBp1

Gene      
Name: ugpB    Texpresso search in the literature
Synonym(s): ECK3437, EG11047, b3453, psiB, psiC
Genome position(nucleotides): 3591009 <-- 3592325 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.68
External database links:  
ASAP:
ABE-0011274
CGSC:
39
ECHOBASE:
EB1040
OU-MICROARRAY:
b3453
PortEco:
ugpB
STRING:
511145.b3453
COLOMBOS: ugpB


Shine dalgarno      
Sequence: tcggtacaacAAGAGAgataaacGAT


Product      
Name: sn-glycerol 3-phosphate ABC transporter periplasmic binding protein
Synonym(s): PsiB, PsiC, UgpB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 48.449
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
24 -> 438 VTTIPFWHSMEGELGKEVDSLAQRFNAENPDYKIVPTYKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQFVPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLKASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEMNKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFYEKNPGADTATRQMLNKPPLPFTKGLRLGNMPQIRVIVDEELESVWTGKKTPQQALDTAVERGNQLLRRFEKSTKS
1 -> 23 MKPLHYTASALALGLALMGNAQA
44 -> 368 LAQRFNAENPDYKIVPTYKGNYEQNLSAGIAAFRTGNAPAILQVYEVGTATMMASKAIKPVYDVFKEAGIQFDESQFVPTVSGYYSDSKTGHLLSQPFNSSTPVLYYNKDAFKKAGLDPEQPPKTWQDLADYAAKLKASGMKCGYASGWQGWIQLENFSAWNGLPFASKNNGFDGTDAVLEFNKPEQVKHIAMLEEMNKKGDFSYVGRKDESTEKFYNGDCAMTTASSGSLANIREYAKFNYGVGMMPYDADAKDAPQNAIIGGASLWVMQGKDKETYTGVAKFLDFLAKPENAAEWHQKTGYLPITKAAYDLTREQGFYEKNPG
334 -> 334 P

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0015794 - glycerol-3-phosphate transmembrane transport
GO:0055085 - transmembrane transport
GO:0001407 - glycerophosphodiester transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
External database links:  
DIP:
DIP-35942N
ECOCYC:
UGPB-MONOMER
ECOLIWIKI:
b3453
INTERPRO:
IPR006061
INTERPRO:
IPR006059
MINT:
MINT-1291422
MODBASE:
P0AG80
PANTHER:
PTHR30061:SF7
PDB:
4AQ4
PFAM:
PF13416
PRIDE:
P0AG80
PRODB:
PRO_000024165
PROSITE:
PS01037
REFSEQ:
NP_417910
SMR:
P0AG80
UNIPROT:
P0AG80


Operon      
Name: ugpBAECQ         
Operon arrangement:
Transcription unit        Promoter
ugpBAECQ
ugpBAECQ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoB
Repressed by: PhoB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB