RegulonDB RegulonDB 10.8: Gene Form
   

ugpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ugpC ugpE ugpQ yhhA ugpA ugpQp1 ugpQp1

Gene      
Name: ugpC    Texpresso search in the literature
Synonym(s): ECK3434, EG11048, b3450
Genome position(nucleotides): 3588110 <-- 3589180 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.7
External database links:  
ASAP:
ABE-0011266
CGSC:
17794
ECHOBASE:
EB1041
OU-MICROARRAY:
b3450
PortEco:
ugpC
STRING:
511145.b3450
COLOMBOS: ugpC


Product      
Name: sn-glycerol 3-phosphate ABC transporter ATP binding subunit
Synonym(s): UgpC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 39.524
Isoelectric point: 7.849
Motif(s):
 
Type Positions Sequence
21 -> 162 KPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGDIWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPL
37 -> 44 GPSGCGKS
4 -> 235 LKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGDIWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFI
135 -> 138 LSGG
236 -> 285 GSPAMNLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015169 - glycerol-3-phosphate transmembrane transporter activity
GO:0015430 - ATPase-coupled glycerol-3-phosphate transmembrane transporter activity
GO:0001406 - glycerophosphodiester transmembrane transporter activity
biological_process GO:0008643 - carbohydrate transport
GO:0015794 - glycerol-3-phosphate transmembrane transport
GO:0001407 - glycerophosphodiester transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11079N
ECOCYC:
UGPC-MONOMER
ECOLIWIKI:
b3450
INTERPRO:
IPR017871
INTERPRO:
IPR040582
INTERPRO:
IPR027417
INTERPRO:
IPR017922
INTERPRO:
IPR008995
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P10907
PFAM:
PF00005
PFAM:
PF17912
PRIDE:
P10907
PRODB:
PRO_000024166
PROSITE:
PS00211
PROSITE:
PS51315
PROSITE:
PS50893
REFSEQ:
NP_417907
SMART:
SM00382
SMR:
P10907
UNIPROT:
P10907


Operon      
Name: ugpBAECQ         
Operon arrangement:
Transcription unit        Promoter
ugpBAECQ
ugpBAECQ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoB
Repressed by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ugpQp1 3588300 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB