RegulonDB RegulonDB 10.8: Gene Form
   

ugpE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ugpB ugpC ugpA ugpE ugpQ terminator ugpQp1 ugpQp1

Gene      
Name: ugpE    Texpresso search in the literature
Synonym(s): ECK3435, EG11049, b3451
Genome position(nucleotides): 3589182 <-- 3590027 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.37
External database links:  
ASAP:
ABE-0011270
CGSC:
17791
ECHOBASE:
EB1042
OU-MICROARRAY:
b3451
PortEco:
ugpE
STRING:
511145.b3451
COLOMBOS: ugpE


Product      
Name: sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE
Synonym(s): UgpE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 31.5
Isoelectric point: 6.249
Motif(s):
 
Type Positions Sequence
77 -> 268 LLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFITLMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARIDGASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIATGEGTTEWNSVMVAMLLTLIPPVVIVLVM
16 -> 36 LILGIAVILFPLYVAFVAATL
113 -> 133 FFWMIFITLMLPVEVRIFPTV
202 -> 222 ALFVITFIYGWNQYLWPLLII
142 -> 162 LDSYAGLTLPLMASATATFLF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0055052 - ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
molecular_function GO:0015169 - glycerol-3-phosphate transmembrane transporter activity
biological_process GO:0015794 - glycerol-3-phosphate transmembrane transport
GO:0055085 - transmembrane transport
GO:0001407 - glycerophosphodiester transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
UGPE-MONOMER
ECOLIWIKI:
b3451
INTERPRO:
IPR030165
INTERPRO:
IPR035906
INTERPRO:
IPR000515
PANTHER:
PTHR43744:SF8
PFAM:
PF00528
PRIDE:
P10906
PRODB:
PRO_000024167
PROSITE:
PS50928
REFSEQ:
NP_417908
SMR:
P10906
UNIPROT:
P10906


Operon      
Name: ugpBAECQ         
Operon arrangement:
Transcription unit        Promoter
ugpBAECQ
ugpBAECQ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, PhoB
Repressed by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ugpQp1 3588300 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB