RegulonDB RegulonDB 10.9: Gene Form
   

uhpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uhpB uhpC uhpA ilvN CRP anti-terminator terminator TSS_4250 TSS_4250 uhpBp uhpBp

Gene      
Name: uhpA    Texpresso search in the literature
Synonym(s): ECK3660, EG11051, b3669
Genome position(nucleotides): 3850136 <-- 3850726 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.88
External database links:  
ASAP:
ABE-0011995
CGSC:
15437
ECHOBASE:
EB1044
ECOLIHUB:
uhpA
OU-MICROARRAY:
b3669
STRING:
511145.b3669
COLOMBOS: uhpA


Product      
Name: DNA-binding transcriptional activator UhpA
Synonym(s): UhpA, UhpA response regulator
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 20.889
Isoelectric point: 6.008
Motif(s):
 
Type Positions Sequence
137 -> 190 PLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSNDVELAR
3 -> 116 TVALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISMPDISGLELLSQLPKGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAVHTVA
4 -> 112 VALIDDHLIVRSGFAQLLGLEPDLQVVAEFGSGREALAGLPGRGVQVCICDISMPDISGLELLSQLPKGMATIMLSVHDSPALVEQALNAGARGFLSKRCSPDELIAAV
131 -> 196 ASGRQDPLTKRERQVAEKLAQGMAVKEIAAELGLSPKTVHVHRANLMEKLGVSNDVELARRMFDGW
54 -> 54 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Evidence: [AIFS] Automated inference of function from sequence
[APPH] Assay of protein purified to homogeneity
[GEA] Gene expression analysis
[IMP] Inferred from mutant phenotype
Reference(s): [1] Burland V., et al., 1993
[2] Dahl JL., et al., 1997
[3] Friedrich MJ., et al., 1987
[4] Island MD., et al., 1992
[5] Merkel TJ., et al., 1992
[6] Olekhnovich IN., et al., 1999
[7] Olekhnovich IN., et al., 2002
[8] Pao GM., et al., 1995
[9] Parkinson JS. 1993
[10] Parkinson JS., et al., 1992
[11] Stock AM., et al., 2000
[12] Stock JB., et al., 1990
[13] Webber CA., et al., 1995
[14] Webber CA., et al., 1997
External database links:  
DIP:
DIP-11082N
ECOCYC:
UHPA-MONOMER
ECOLIWIKI:
b3669
INTERPRO:
IPR011006
INTERPRO:
IPR016032
INTERPRO:
IPR001789
INTERPRO:
IPR000792
MODBASE:
P0AGA6
PFAM:
PF00072
PFAM:
PF00196
PRIDE:
P0AGA6
PRINTS:
PR00038
PRODB:
PRO_000024168
PROSITE:
PS50110
PROSITE:
PS50043
PROSITE:
PS00622
REFSEQ:
NP_418125
SMART:
SM00421
SMART:
SM00448
SMR:
P0AGA6
UNIPROT:
P0AGA6


Operon      
Name: ivbL-ilvBN-uhpABC         
Operon arrangement:
Transcription unit        Promoter
uhpB
ivbL
ivbL-ilvBN
ivbL-ilvBN-uhpABC
uhpABC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4250 3850755 reverse nd [RS-EPT-CBR] [15]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burland V., Plunkett G., Daniels DL., Blattner FR., 1993, DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication., Genomics 16(3):551-61

 [2] Dahl JL., Wei BY., Kadner RJ., 1997, Protein phosphorylation affects binding of the Escherichia coli transcription activator UhpA to the uhpT promoter., J Biol Chem 272(3):1910-9

 [3] Friedrich MJ., Kadner RJ., 1987, Nucleotide sequence of the uhp region of Escherichia coli., J Bacteriol 169(8):3556-63

 [4] Island MD., Wei BY., Kadner RJ., 1992, Structure and function of the uhp genes for the sugar phosphate transport system in Escherichia coli and Salmonella typhimurium., J Bacteriol 174(9):2754-62

 [5] Merkel TJ., Nelson DM., Brauer CL., Kadner RJ., 1992, Promoter elements required for positive control of transcription of the Escherichia coli uhpT gene., J Bacteriol 174(9):2763-70

 [6] Olekhnovich IN., Dahl JL., Kadner RJ., 1999, Separate contributions of UhpA and CAP to activation of transcription of the uhpT promoter of Escherichia coli., J Mol Biol 292(5):973-86

 [7] Olekhnovich IN., Kadner RJ., 2002, Mutational scanning and affinity cleavage analysis of UhpA-binding sites in the Escherichia coli uhpT promoter., J Bacteriol 184(10):2682-91

 [8] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [9] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [10] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [11] Stock AM., Robinson VL., Goudreau PN., 2000, Two-component signal transduction., Annu Rev Biochem 69:183-215

 [12] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [13] Webber CA., Kadner RJ., 1995, Action of receiver and activator modules of UhpA in transcriptional control of the Escherichia coli sugar phosphate transport system., Mol Microbiol 15(5):883-93

 [14] Webber CA., Kadner RJ., 1997, Involvement of the amino-terminal phosphorylation module of UhpA in activation of uhpT transcription in Escherichia coli., Mol Microbiol 24(5):1039-48

 [15] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB