RegulonDB RegulonDB 10.9: Gene Form
   

usg gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdxB usg truA dedA anti-anti-terminator anti-terminator TSS_2626 TSS_2626 usgp usgp dedAp2 dedAp2

Gene      
Name: usg    Texpresso search in the literature
Synonym(s): ECK2313, EG11059, b2319, usg-1
Genome position(nucleotides): 2435636 <-- 2436649 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.93
External database links:  
ASAP:
ABE-0007660
ECHOBASE:
EB1052
ECOLIHUB:
usg
OU-MICROARRAY:
b2319
STRING:
511145.b2319
COLOMBOS: usg


Shine dalgarno      
Sequence: ttgctatttcTGGAGTaaaccacCAT


Product      
Name: putative semialdehyde dehydrogenase Usg
Synonym(s): Usg
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.364
Isoelectric point: 4.113
Motif(s):
 
Type Positions Sequence
141 -> 317 LKPLIDQGGLSRISVTSLISASAQGKKAVDALAGQSAKLLNGIPIDEEDFFGRQLAFNMLPLLPDSEGSVREERRIVDEVRKILQDEGLMISASVVQAPVFYGHAQMVNFEALRPLAAEEARDAFVQGEDIVLSEENEFPTQVGDASGTPHLSVGCVRNDYGMPEQVQFWSVADNVR
6 -> 117 NIAVLGATGAVGEALLETLAERQFPVGEIYALARNESAGEQLRFGGKTITVQDAAEFDWTQAQLAFFVAGKEATAAWVEEATNSGCLVIDSSGLFALEPDVPLVVPEVNPFV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0046983 - protein dimerization activity
GO:0051287 - NAD binding
biological_process GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11095N
ECOCYC:
EG11059-MONOMER
ECOLIWIKI:
b2319
INTERPRO:
IPR036291
INTERPRO:
IPR012280
INTERPRO:
IPR000534
MODBASE:
P08390
PFAM:
PF01118
PFAM:
PF02774
PRIDE:
P08390
PRODB:
PRO_000024188
REFSEQ:
NP_416822
SMART:
SM00859
SMR:
P08390
UNIPROT:
P08390


Operon      
Name: pdxB-usg-truA-dedA         
Operon arrangement:
Transcription unit        Promoter
usg-truA-dedA
pdxB-usg-truA-dedA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter dedAp2 2434940 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2626 2437519 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB