RegulonDB RegulonDB 10.8: Gene Form
   

ushA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ushA fsr ybaK TSS_645 TSS_645 ushAp6 ushAp6 TSS_644 TSS_644 fsrp9 fsrp9 fsrp5 fsrp5 fsrp6 fsrp6 fsrp8 fsrp8

Gene      
Name: ushA    Texpresso search in the literature
Synonym(s): ECK0474, EG11060, b0480
Genome position(nucleotides): 504914 --> 506566 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.88
Reference(s): [1] Burns DM., et al., 1983
[2] Burns DM., et al., 1986
[3] Cowman A., et al., 1980
External database links:  
ASAP:
ABE-0001668
CGSC:
22
ECHOBASE:
EB1053
MIM:
211800
OU-MICROARRAY:
b0480
PortEco:
ushA
STRING:
511145.b0480
COLOMBOS: ushA


Product      
Name: 5'-nucleotidase / UDP-sugar hydrolase
Synonym(s): UshA
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 60.824
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence
1 -> 25 MKLLQRGVALALLTTFTLASETALA
363 -> 509 KIGETNGRLEGDRDKVRFVQTNMGRLILAAQMDRTGADFAVMSGGGIRDSIEAGDISYKNVLKVQPFGNVVVYADMTGKEVIDYLTAVAQMKPDSGAYPQFANVSFVAKDGKLNDLKIKGEPVDPAKTYRMATLNFNATGGDGYPRL
26 -> 342 YEQDKTYKITVLHTNDHHGHFWRNEYGEYGLAAQKTLVDGIRKEVAAEGGSVLLLSGGDINTGVPESDLQDAEPDFRGMNLVGYDAMAIGNHEFDNPLTVLRQQEKWAKFPLLSANIYQKSTGERLFKPWALFKRQDLKIAVIGLTTDDTAKIGNPEYFTDIEFRKPADEAKLVIQELQQTEKPDIIIAATHMGHYDNGEHGSNAPGDVEMARALPAGSLAMIVGGHSQDPVCMAAENKKQVDYVPGTPCKPDQQNGIWIVQAHEWGKYVGRADFEFRNGEMKMVNYQLIPVNLKKKVTWEDGKSERVLYTPEIAEN
343 -> 361 QQMISLLSPFQNKGKAQLE
498 -> 504 FNATGGD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.10 - sugar nucleotide biosynthesis, conversions
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008253 - 5'-nucleotidase activity
GO:0000166 - nucleotide binding
GO:0008768 - UDP-sugar diphosphatase activity
biological_process GO:0016311 - dephosphorylation
GO:0009166 - nucleotide catabolic process
Note(s): Note(s): ...[more].
Reference(s): [4] Edwards CJ., et al., 1993
[5] Krug U., et al., 2013
[6] Neu HC. 1967
[7] Taylor N., et al., 1975
[8] Taylor NS., et al., 1975
External database links:  
DIP:
DIP-11096N
ECOCYC:
USHA-MONOMER
ECOLIWIKI:
b0480
INTERPRO:
IPR006146
INTERPRO:
IPR008334
INTERPRO:
IPR029052
INTERPRO:
IPR036907
INTERPRO:
IPR006179
INTERPRO:
IPR004843
MINT:
MINT-1256646
MODBASE:
P07024
PANTHER:
PTHR11575
PDB:
2USH
PDB:
1USH
PDB:
1OIE
PDB:
1OID
PDB:
1OI8
PDB:
1HPU
PDB:
1HP1
PDB:
1HO5
PDB:
4WWL
PFAM:
PF00149
PFAM:
PF02872
PRIDE:
P07024
PRINTS:
PR01607
PRODB:
PRO_000024189
PROSITE:
PS00785
PROSITE:
PS00786
REFSEQ:
NP_415013
SMR:
P07024
UNIPROT:
P07024


Operon      
Name: ushA         
Operon arrangement:
Transcription unit        Promoter
ushA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter fsrp8 504767 reverse Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter fsrp6 504847 reverse Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter fsrp5 504852 reverse Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter fsrp9 504855 reverse Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_644 504883 forward nd [RS-EPT-CBR] [10]
  promoter ushAp6 504886 forward Similarity to the consensus
Read more >
[ICWHO] [9]
  promoter TSS_645 504888 forward nd [RS-EPT-CBR] [10]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Burns DM., Abraham LJ., Beacham IR., 1983, Characterization of the ush gene of Escherichia coli and its protein products., Gene 25(2-3):343-53

 [2] Burns DM., Beacham IR., 1986, Nucleotide sequence and transcriptional analysis of the E. coli ushA gene, encoding periplasmic UDP-sugar hydrolase (5'-nucleotidase): regulation of the ushA gene, and the signal sequence of its encoded protein product., Nucleic Acids Res 14(10):4325-42

 [3] Cowman A., Beacham IR., 1980, Molecular cloning of the gene (ush) from Escherichia coli specifying periplasmic UDP-sugar hydrolase (5'-nucleotidase)., Gene 12(3-4):281-6

 [4] Edwards CJ., Innes DJ., Burns DM., Beacham IR., 1993, UDP-sugar hydrolase isozymes in Salmonella enterica and Escherichia coli: silent alleles of ushA in related strains of group I Salmonella isolates, and of ushB in wild-type and K12 strains of E. coli, indicate recent and early silencing events, respectively., FEMS Microbiol Lett 114(3):293-8

 [5] Krug U., Patzschke R., Zebisch M., Balbach J., Strater N., 2013, Contribution of the two domains of E. coli 5'-nucleotidase to substrate specificity and catalysis., FEBS Lett 587(5):460-6

 [6] Neu HC., 1967, The 5'-nucleotidase of Escherichia coli. II. Surface localization and purification of the Escherichia coli 5'-nucleotidase inhibitor., J Biol Chem 242(17):3905-11

 [7] Taylor N., Beacham IR., 1975, Synthesis of Escherichia coli uridine diphosphate glucose hydrolase, and demonstration of an inhibitor, in Salmonella typhimurium cytoplasm., Biochem Soc Trans 3(3):386-7

 [8] Taylor NS., Beacham IR., 1975, Synthesis and localisation of Escherichia coli UDP-glucose hydrolase (5'-nucleotidase), and demonstration of a cytoplasmic inhibitor of this enzyme in Salmonella typhimurium., Biochim Biophys Acta 411(2):216-21

 [9] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [10] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB