RegulonDB RegulonDB 10.8: Gene Form
   

frsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frsA insB9 gpt insA9 terminator anti-terminator anti-anti-terminator crlp2 crlp2 crlp1 crlp1 TSS_455 TSS_455 frsAp frsAp

Gene      
Name: frsA    Texpresso search in the literature
Synonym(s): ECK0240, EG11091, b0239, yafA
Genome position(nucleotides): 256527 --> 257771 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0000817
ECHOBASE:
EB1083
OU-MICROARRAY:
b0239
PortEco:
frsA
STRING:
511145.b0239
COLOMBOS: frsA


Product      
Name: fermentation-respiration switch protein
Synonym(s): FrsA, YafA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 47.009
Isoelectric point: 6.956
Motif(s):
 
Type Positions Sequence
397 -> 414 NFDKGLQEITDWIEKRLC
1 -> 414 MTQANLSETLFKPRFKHPETSTLVRRFNHGAQPPVQSALDGKTIPHWYRMINRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQKACAEDDPQLSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQRLPGTMRQMEFTVPGGAPITGFLHMPKGDGPFPTVLMCGGLDAMQTDYYSLYERYFAPRGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVRLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELNRYSLKVQGLLGRRCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNFDKGLQEITDWIEKRLC
277 -> 278 NV
242 -> 242 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.6 - aerobic respiration
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0080030 - methyl indole-3-acetate esterase activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0052689 - carboxylic ester hydrolase activity
biological_process GO:0043470 - regulation of carbohydrate catabolic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Koo BM., et al., 2004
[2] Kuznetsova E., et al., 2005
External database links:  
DIP:
DIP-11208N
ECOCYC:
EG11091-MONOMER
ECOLIWIKI:
b0239
INTERPRO:
IPR029058
INTERPRO:
IPR010520
MODBASE:
P04335
PFAM:
PF06500
PRIDE:
P04335
PRODB:
PRO_000022698
REFSEQ:
NP_414774
SMR:
P04335
UNIPROT:
P04335


Operon      
Name: frsA         
Operon arrangement:
Transcription unit        Promoter
frsA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_455 256509 forward nd [RS-EPT-CBR] [3]
  promoter crlp1 257810 forward Zaslaver et al. demonstrated
Read more >
[CV(RS-EPT-CBR/TA)], [CV(TA/TIM)], [HTIM], [IEP], [RS-EPT-CBR], [TIM] [3], [4], [5], [6]
  promoter crlp2 257824 forward This promoter was identified
Read more >
[HIPP], [IEP] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [CV(RS-EPT-CBR/TA)] cross validation(RS-EPT-CBR/TA)

 [CV(TA/TIM)] cross validation(TA/TIM)

 [HTIM] High-throughput transcription initiation mapping

 [IEP] Inferred from expression pattern

 [TIM] Transcription initiation mapping

 [HIPP] Human inference of promoter position



Reference(s)    

 [1] Koo BM., Yoon MJ., Lee CR., Nam TW., Choe YJ., Jaffe H., Peterkofsky A., Seok YJ., 2004, A novel fermentation/respiration switch protein regulated by enzyme IIAGlc in Escherichia coli., J Biol Chem 279(30):31613-21

 [2] Kuznetsova E., Proudfoot M., Sanders SA., Reinking J., Savchenko A., Arrowsmith CH., Edwards AM., Yakunin AF., 2005, Enzyme genomics: Application of general enzymatic screens to discover new enzymes., FEMS Microbiol Rev 29(2):263-79

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Arnqvist A., Olsen A., Pfeifer J., Russell DG., Normark S., 1992, The Crl protein activates cryptic genes for curli formation and fibronectin binding in Escherichia coli HB101., Mol Microbiol 6(17):2443-52

 [5] Mendoza-Vargas A., Olvera L., Olvera M., Grande R., Vega-Alvarado L., Taboada B., Jimenez-Jacinto V., Salgado H., Juarez K., Contreras-Moreira B., Huerta AM., Collado-Vides J., Morett E., 2009, Genome-wide identification of transcription start sites, promoters and transcription factor binding sites in E. coli., PLoS One 4(10):e7526

 [6] Zaslaver A., Bren A., Ronen M., Itzkovitz S., Kikoin I., Shavit S., Liebermeister W., Surette MG., Alon U., 2006, A comprehensive library of fluorescent transcriptional reporters for Escherichia coli., Nat Methods 3(8):623-8

 [7] Zhao K., Liu M., Burgess RR., 2010, Promoter and regulon analysis of nitrogen assimilation factor, sigma54, reveal alternative strategy for E. coli MG1655 flagellar biosynthesis., Nucleic Acids Res 38(4):1273-83


RegulonDB