RegulonDB RegulonDB 10.9: Gene Form
   

crl gene in Escherichia coli K-12 genome

Gene      
Name: crl    Texpresso search in the literature
Synonym(s): ECK0241, EG11092, b0240
Type: Pseudo Gene
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.5
External database links:  
ASAP:
ABE-0000821
CGSC:
30625
ECHOBASE:
EB1084
ECOLIHUB:
crl
OU-MICROARRAY:
b0240
STRING:
511145.b0240
COLOMBOS: crl


Product      
Name: RNA polymerase holoenzyme assembly factor Crl
Sequence: Get amino acid sequence Fasta Format
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
2 -> 133 TLPSGHPKSRLIKKFTALGPYIREGKCKDNRFFFDCLAVCVNVKPAPEVREFWGWWMELEAQESRFTYSYQFGLFDKAGDWKSVPVKDTEVVERLEHTLREFHEKLRELLTTLNLKLEPADDFRDEPVKLTA
13 -> 13 I
29 -> 29 K
8 -> 8 P
99 -> 122 TLREFHEKLRELLTTLNLKLEPAD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
biological_process GO:0045893 - positive regulation of transcription, DNA-templated
GO:0034622 - cellular protein-containing complex assembly
GO:2000144 - positive regulation of DNA-templated transcription, initiation
Note(s): Note(s): ...[more].
Reference(s): [1] Cavaliere P., et al., 2018
[2] Gonzalez Barrios AF., et al., 2006
[3] Kang MJ., et al., 2005
External database links:  
ECOCYC:
EG11092-MONOMER
ECOLIWIKI:
b0240
INTERPRO:
IPR038208
INTERPRO:
IPR009986
PFAM:
PF07417
PRIDE:
P24251
PRODB:
PRO_000022332
REFSEQ:
NP_414775
SMR:
P24251
UNIPROT:
P24251


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Cavaliere P., Brier S., Filipenko P., Sizun C., Raynal B., Bonnete F., Levi-Acobas F., Bellalou J., England P., Chamot-Rooke J., Mayer C., Norel F., 2018, The stress sigma factor of RNA polymerase RpoS/σS is a solvent-exposed open molecule in solution., Biochem J 475(1):341-354

 [2] Gonzalez Barrios AF., Zuo R., Hashimoto Y., Yang L., Bentley WE., Wood TK., 2006, Autoinducer 2 Controls Biofilm Formation in Escherichia coli through a Novel Motility Quorum-Sensing Regulator (MqsR, B3022)., J Bacteriol 188(1):305-16

 [3] Kang MJ., Lee YM., Yoon SH., Kim JH., Ock SW., Jung KH., Shin YC., Keasling JD., Kim SW., 2005, Identification of genes affecting lycopene accumulation in Escherichia coli using a shot-gun method., Biotechnol Bioeng 91(5):636-42


RegulonDB