RegulonDB RegulonDB 10.8: Gene Form
   

aes gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gsk hemH aes adk OxyR OxyR aesp aesp TSS_643 TSS_643 TSS_642 TSS_642 hemHp hemHp

Gene      
Name: aes    Texpresso search in the literature
Synonym(s): ECK0470, EG11101, b0476, ybaC
Genome position(nucleotides): 499014 <-- 499973 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.08
External database links:  
ASAP:
ABE-0001651
ECHOBASE:
EB1093
OU-MICROARRAY:
b0476
PortEco:
aes
STRING:
511145.b0476
COLOMBOS: aes


Shine dalgarno      
Sequence: gtaatttgaaAGGAGTttttgTAT


Product      
Name: acetylesterase
Synonym(s): Aes, YbaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.034
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
87 -> 295 LFYLHGGGFILGNLDTHDRIMRLLASYSQCTVIGIDYTLSPEARFPQAIEEIVAACCYFHQQAEDYQINMSRIGFAGDSAGAMLALASALWLRDKQIDCGKVAGVLLWYGLYGLRDSVTRRLLGGVWDGLTQQDLQMYEEAYLSNDADRESPYYCLFNNDLTREVPPCFIAGAEFDPLLDDSRLLYQTLAAHQQPCEFKLYPGTLHAFL
103 -> 103 H
262 -> 262 D
128 -> 128 E
167 -> 167 G

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0008126 - acetylesterase activity
GO:0042803 - protein homodimerization activity
GO:0034338 - short-chain carboxylesterase activity
GO:0052689 - carboxylic ester hydrolase activity
biological_process GO:0009056 - catabolic process
GO:0043433 - negative regulation of DNA-binding transcription factor activity
GO:0051346 - negative regulation of hydrolase activity
External database links:  
DIP:
DIP-9062N
ECOCYC:
EG11101-MONOMER
ECOLIWIKI:
b0476
INTERPRO:
IPR013094
INTERPRO:
IPR033140
INTERPRO:
IPR029058
INTERPRO:
IPR023508
INTERPRO:
IPR002168
MODBASE:
P23872
PDB:
4KRY
PDB:
4KRX
PFAM:
PF07859
PRIDE:
P23872
PRODB:
PRO_000022064
PROSITE:
PS01174
PROSITE:
PS01173
REFSEQ:
NP_415009
SMR:
P23872
UNIPROT:
P23872


Operon      
Name: aes         
Operon arrangement:
Transcription unit        Promoter
aes


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_642 499566 forward nd [RS-EPT-CBR] [1]
  promoter TSS_643 499570 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB