RegulonDB RegulonDB 10.9: Gene Form
   

gsk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybaL gsk aes hemH aesp aesp TSS_643 TSS_643 TSS_642 TSS_642

Gene      
Name: gsk    Texpresso search in the literature
Synonym(s): ECK0471, EG11102, b0477
Genome position(nucleotides): 500125 --> 501429 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.88
Reference(s): [1] Harlow KW., et al., 1995
[2] Mori H., et al., 1995
External database links:  
ASAP:
ABE-0001655
CGSC:
658
ECHOBASE:
EB1094
ECOLIHUB:
gsk
NCBI-GENE:
946584
OU-MICROARRAY:
b0477
STRING:
511145.b0477
COLOMBOS: gsk


Product      
Name: inosine/guanosine kinase
Synonym(s): Gsk
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 48.449
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
326 -> 326 R
314 -> 314 A
421 -> 423 PER
78 -> 293 QELKQKNLITHQFAGGTIGNTMHNYSVLADDRSVLLGVMCSNIEIGSYAYRYLCNTSSRTDLNYLQGVDGPIGRCFTLIGESGERTFAISPGHMNQLRAESIPEDVIAGASALVLTSYLVRCKPGEPMPEATMKAIEYAKKYNVPVVLTLGTKFVIAENPQWWQQFLKDHVSILAMNEDEAEALTGESDPLLASDKALDWVDLVLCTAGPIGLYMA
365 -> 366 LH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0016773 - phosphotransferase activity, alcohol group as acceptor
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008906 - inosine kinase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0016310 - phosphorylation
GO:0032264 - IMP salvage
External database links:  
DIP:
DIP-48148N
ECOCYC:
GSK-MONOMER
ECOLIWIKI:
b0477
INTERPRO:
IPR002173
INTERPRO:
IPR011611
INTERPRO:
IPR029056
MODBASE:
P0AEW6
PFAM:
PF00294
PRIDE:
P0AEW6
PRODB:
PRO_000022848
PROSITE:
PS00584
REFSEQ:
NP_415010
UNIPROT:
P0AEW6


Operon      
Name: gsk         
Operon arrangement:
Transcription unit        Promoter
gsk


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_642 499566 forward nd [RS-EPT-CBR] [3]
  promoter TSS_643 499570 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Harlow KW., Nygaard P., Hove-Jensen B., 1995, Cloning and characterization of the gsk gene encoding guanosine kinase of Escherichia coli., J Bacteriol 177(8):2236-40

 [2] Mori H., Iida A., Teshiba S., Fujio T., 1995, Cloning of a guanosine-inosine kinase gene of Escherichia coli and characterization of the purified gene product., J Bacteriol 177(17):4921-6

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB