RegulonDB RegulonDB 10.9: Gene Form
   

mngR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mngA mngR sdhX MngR MngR mngBp mngBp mngBp2 mngBp2 mngRp mngRp TSS_861 TSS_861 mngAp mngAp

Gene      
Name: mngR    Texpresso search in the literature
Synonym(s): ECK0718, EG11109, b0730, farR, ybgB
Genome position(nucleotides): 765153 <-- 765875 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.13
External database links:  
ASAP:
ABE-0002487
CGSC:
36837
ECHOBASE:
EB1100
ECOLIHUB:
mngR
ECOO157CYC:
Z4874
OU-MICROARRAY:
b0730
STRING:
511145.b0730
COLOMBOS: mngR


Product      
Name: DNA-binding transcriptional repressor MngR
Synonym(s): FarR, MngR, YbgB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 28.273
Isoelectric point: 6.693
Motif(s):
 
Type Positions Sequence
6 -> 69 LYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVTVRQALRQLVEQQILESIQGSGTYV
32 -> 51 ESALQTEFGVSRVTVRQALR
91 -> 229 RHVDTHSEVLIFEVIPADDFLQQQLQITPQDRVWHVKRVRYRKQKPMALEETWMPLALFPDLTWQVMENSKYHFIEEVKKMVIDRSEQEIIPLMPTEEMSRLLNISQTKPILEKVSRGYLVDGRVFEYSRNAFNTDDYK
4 -> 72 KPLYRQIADRIREQIARGELKPGDALPTESALQTEFGVSRVTVRQALRQLVEQQILESIQGSGTYVKEE

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0009408 - response to heat
GO:0045892 - negative regulation of transcription, DNA-templated
Reference(s): [1] Quail MA., et al., 1994
External database links:  
DIP:
DIP-9565N
ECOCYC:
PD01103
ECOLIWIKI:
b0730
ECOO157CYC:
Z4874-MONOMER
INTERPRO:
IPR036388
INTERPRO:
IPR036390
INTERPRO:
IPR028978
INTERPRO:
IPR011663
INTERPRO:
IPR000524
MODBASE:
P13669
PFAM:
PF07702
PFAM:
PF00392
PRIDE:
P13669
PRINTS:
PR00035
PRODB:
PRO_000023253
PROSITE:
PS50949
REFSEQ:
NP_415258
SMART:
SM00866
SMART:
SM00345
SMR:
P13669
UNIPROT:
P13669


Operon      
Name: mngR         
Operon arrangement:
Transcription unit        Promoter
mngR


Transcriptional Regulation      
Display Regulation             
Repressed by: MngR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_861 765899 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Quail MA., Dempsey CE., Guest JR., 1994, Identification of a fatty acyl responsive regulator (FarR) in Escherichia coli., FEBS Lett 356(2-3):183-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB