RegulonDB RegulonDB 10.9: Gene Form
   

yceB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pyrC grxB yceB Fur PurR Cis-reg; leader anti-anti-terminator anti-terminator terminator terminator TSS_1336 TSS_1336 TSS_1335 TSS_1335 pyrCp pyrCp

Gene      
Name: yceB    Texpresso search in the literature
Synonym(s): ECK1048, EG11117, b1063
Genome position(nucleotides): 1122713 <-- 1123273 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.88
External database links:  
ASAP:
ABE-0003611
ECHOBASE:
EB1107
ECOLIHUB:
yceB
OU-MICROARRAY:
b1063
STRING:
511145.b1063
COLOMBOS: yceB


Product      
Name: putative lipid-binding lipoprotein YceB
Synonym(s): YceB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.5
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
19 -> 186 CNQLTQYTITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQALRNYFNQQPAYVLREDGSQGEAMAKKLAKGIEVKPGEIVIPFTD
27 -> 178 ITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQALRNYFNQQPAYVLREDGSQGEAMAKKLAKGIEVKPG
1 -> 18 MNKFLFAAALIVSGLLVG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Kopec KO., et al., 2011
External database links:  
ECOCYC:
EG11117-MONOMER
ECOLIWIKI:
b1063
INTERPRO:
IPR010835
PDB:
3L6I
PFAM:
PF07273
PRIDE:
P0AB26
PROSITE:
PS51257
REFSEQ:
NP_415581
SMR:
P0AB26
UNIPROT:
P0AB26


Operon      
Name: yceB         
Operon arrangement:
Transcription unit        Promoter
yceB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1335 1123108 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1336 1123297 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kopec KO., Alva V., Lupas AN., 2011, Bioinformatics of the TULIP domain superfamily., Biochem Soc Trans 39(4):1033-8

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB