RegulonDB RegulonDB 10.9: Gene Form
   

tfaE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycfK tfaE pinE stfE tfaP mcrAp10 mcrAp10 mcrAp7 mcrAp7 pinEp3 pinEp3 pinEp1 pinEp1 tfaEp1 tfaEp1 tfaEp6 tfaEp6

Gene      
Name: tfaE    Texpresso search in the literature
Synonym(s): ECK1142, EG11120, b1156, ycfA
Genome position(nucleotides): 1208517 <-- 1209119 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.76
External database links:  
ASAP:
ABE-0003880
ECHOBASE:
EB1110
ECOLIHUB:
tfaE
OU-MICROARRAY:
b1156
STRING:
511145.b1156
COLOMBOS: tfaE


Product      
Name: e14 prophage; putative tail fiber assembly protein TfaE
Synonym(s): TfaE, YcfA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 21.662
Isoelectric point: 4.304
Motif(s):
 
Type Positions Sequence
78 -> 199 RGETVYSTKTGESKEIKAPGDYPENTTTIAPLSPYDKWDGEKWVTDTEAQHSAAVDAAEAQRQSLIDAAMASISLIQLKLQAGRKLTQAETTRLNAVLDYIDAVTATDTSTAPDVIWPELPE
200 -> 200 A

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Mehta P., et al., 2004
External database links:  
ECOCYC:
EG11120-MONOMER
ECOLIWIKI:
b1156
INTERPRO:
IPR003458
PFAM:
PF02413
PRIDE:
P09153
REFSEQ:
NP_415674
UNIPROT:
P09153


Operon      
Name: stfE-tfaE         
Operon arrangement:
Transcription unit        Promoter
stfE-tfaE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tfaEp6 1209189 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter tfaEp1 1209266 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pinEp1 1209527 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter pinEp3 1209672 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mcrAp7 1210139 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter mcrAp10 1210195 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Mehta P., Casjens S., Krishnaswamy S., 2004, Analysis of the lambdoid prophage element e14 in the E. coli K-12 genome., BMC Microbiol 4:4

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB