RegulonDB RegulonDB 11.0: Gene Form
   

ompW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yciC ompW yciE ArcA NarL CRP FNR FNR ompWp ompWp yciCp yciCp TSS_1685 TSS_1685 yciBp3 yciBp3

Gene      
Name: ompW    Texpresso search in the literature
Synonym(s): ECK1250, EG11124, b1256, yciD
Genome position(nucleotides): 1314020 --> 1314658
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.08
External database links:  
ASAP:
ABE-0004210
ECHOBASE:
EB1114
ECOLIHUB:
ompW
OU-MICROARRAY:
b1256
STRING:
511145.b1256
COLOMBOS: ompW


Product      
Name: outer membrane protein W
Synonym(s): OmpW, YciD
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 22.928
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence Comment
1 -> 21 MKKLTVAALAVTTLLSGSAFA
12 -> 12 T UniProt: In strain: ECOR 52 and ECOR 60..
20 -> 20 F UniProt: In strain: ECOR 46 and ECOR 50..
22 -> 212 HEAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF UniProt: Outer membrane protein W.
23 -> 212 EAGEFFMRAGSATVRPTEGAGGTLGSLGGFSVTNNTQLGLTFTYMATDNIGVELLAATPFRHKIGTRATGDIATVHHLPPTLMAQWYFGDASSKFRPYVGAGINYTTFFDNGFNDHGKEAGLSDLSLKDSWGAAGQVGVDYLINRDWLVNMSVWYMDIDTTANYKLGGAQQHDSVRLDPWVFMFSAGYRF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0019867 - outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Evidence: [IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Pilsl H., et al., 1999
[2] Xu C., et al., 2006
External database links:  
ALPHAFOLD:
P0A915
ECOCYC:
EG11124-MONOMER
ECOLIWIKI:
b1256
INTERPRO:
IPR005618
INTERPRO:
IPR011250
MINT:
P0A915
MODBASE:
P0A915
PANTHER:
PTHR36920
PDB:
2F1V
PDB:
2F1T
PFAM:
PF03922
PRIDE:
P0A915
PRODB:
PRO_000023459
REFSEQ:
NP_415772
SMR:
P0A915
SWISSMODEL:
P0A915
UNIPROT:
P0A915


Operon      
Name: ompW         
Operon arrangement:
Transcription unit        Promoter
ompW


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, Fur
Repressed by: CRP, FNR, SoxS, ArcA, NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yciBp3 1313055 reverse nd [ICWHO] [3]
  promoter TSS_1685 1313354 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pilsl H., Smajs D., Braun V., 1999, Characterization of colicin S4 and its receptor, OmpW, a minor protein of the Escherichia coli outer membrane., J Bacteriol 181(11):3578-81

 [2] Xu C., Lin X., Ren H., Zhang Y., Wang S., Peng X., 2006, Analysis of outer membrane proteome of Escherichia coli related to resistance to ampicillin and tetracycline., Proteomics 6(2):462-73

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB