RegulonDB RegulonDB 10.9: Gene Form
   

ppsR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppsA aroH ppsR TrpR TrpR Cra terminator anti-terminator anti-anti-terminator TSS_1995 TSS_1995 TSS_1994 (cluster) TSS_1994 (cluster) aroHp2 aroHp2 TSS_1992 TSS_1992 aroHp1 aroHp1 TSS_1991 TSS_1991 ppsRp6 ppsRp6 ppsRp8 ppsRp8 ppsRp1 ppsRp1 ppsp ppsp

Gene      
Name: ppsR    Texpresso search in the literature
Synonym(s): ECK1701, EG11132, b1703, ydiA
Genome position(nucleotides): 1787445 --> 1788278 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.32
External database links:  
ASAP:
ABE-0005682
ECHOBASE:
EB1122
ECOLIHUB:
ppsR
OU-MICROARRAY:
b1703
STRING:
511145.b1703
COLOMBOS: ppsR


Product      
Name: phosphoenolpyruvate synthetase regulatory protein
Synonym(s): PEP synthetase regulatory protein, PpsR, YdiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.211
Isoelectric point: 6.402
Motif(s):
 
Type Positions Sequence
9 -> 267 VFYISDGTAITAEVLGHAVMSQFPVTISSITLPFVENESRARAVKDQIDAIYHQTGVRPLVFYSIVLPEIRAIILQSEGFCQDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDGISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDMDNLVLPASLKPLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYSVEEIATKIL
157 -> 164 GVSRCGKT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0005515 - protein binding
GO:0030234 - enzyme regulator activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0016776 - phosphotransferase activity, phosphate group as acceptor
GO:0004674 - protein serine/threonine kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0043531 - ADP binding
biological_process GO:0033673 - negative regulation of kinase activity
GO:0006470 - protein dephosphorylation
GO:0006468 - protein phosphorylation
GO:0016310 - phosphorylation
GO:0050790 - regulation of catalytic activity
GO:0033674 - positive regulation of kinase activity
GO:0051289 - protein homotetramerization
External database links:  
DIP:
DIP-47885N
ECOCYC:
EG11132-MONOMER
ECOLIWIKI:
b1703
INTERPRO:
IPR005177
INTERPRO:
IPR026530
PANTHER:
PTHR31756
PFAM:
PF03618
PRIDE:
P0A8A4
REFSEQ:
NP_416218
UNIPROT:
P0A8A4


Operon      
Name: ppsR         
Operon arrangement:
Transcription unit        Promoter
ppsR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ppsRp1 1787339 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ppsRp8 1787351 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ppsRp6 1787383 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1991 1787415 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1992 1788321 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1994 (cluster) 1788419 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1995 1789271 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB